(data stored in ACNUC7421 zone)

EMBL: CP001349.PE443

CP001349.PE443       Location/Qualifiers
FT   CDS_pept        complement(508211..509926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0453"
FT                   /product="dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: met:M446_1318 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55495"
FT                   /db_xref="GOA:B8ICA7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA7"
FT                   /inference="protein motif:PFAM:PF00920"
FT                   /protein_id="ACL55495.1"
FT                   /translation="MSKGLRKGLTSYGDAGFSLFLRKAFIKAMGYSDDALNRPIVGITN
FT                   TYSDYNPCHGNGPALVEAAKRGVMLAGAMPMVFPTISIHESFAHPTSMFLRNLMAMDTE
FT                   EMIRAQPMDAVIVIGGCDKTLPAQIMAAASVDLPTVVIPVGPMVVGHHKGEVLGACTDC
FT                   RRLWAAHRAGAIDEQEIEMVNGRLAPSVGTCMVMGTASTMACLTEAMGLSLPLSATIPA
FT                   PHAERVRLAEASGRRAAEMAVAGGPRPSAILTPAAFRNAQTVLQAIGGSTNGLIHLTAI
FT                   ARRVRAEIDLDAFDAIGRAVPVLVDLKPSGDHYMEHFHHAGGVPRLLAELGDLIDLDVP
FT                   TVAGEKLRDVVAAAEIVPGQTVIRSPADPIKPTGGLAVLRGNLAPRGALIKHAAASERL
FT                   LQHTGRALVFESIPEMAARIDDPDLDVSPDDVLVLCNAGPKGAPGMPEAGYLPIPKKLA
FT                   RQGVKDMVRISDARMSGTAFGTIVLHVTPESAVGGPLALVRTGDRIRLDVAGRRIDLLV
FT                   DEAELARRAAALPAPPRPAWAERGYARLFHDTVTQADEGCDFDFMRPGGAAQGN"
     atgagcaagg ggttgcgcaa ggggctcacg agctacggcg atgccggttt ctcgctcttc        60
     ctccgcaagg ccttcatcaa ggccatgggc tattccgacg acgcgctgaa ccggccgatc       120
     gtcggcatca ccaacaccta tagcgactac aatccctgcc acggcaatgg tccggcgctg       180
     gtcgaggcgg ccaagcgcgg cgtgatgctg gctggcgcca tgccgatggt gttcccgacc       240
     atctcgatcc acgagagctt cgcccatccg acctccatgt tcctgcgcaa cctgatggcg       300
     atggacacgg aggagatgat ccgggcccag ccgatggacg ctgtcatcgt catcggcggc       360
     tgcgacaaga ccctgccggc ccagatcatg gccgcggcga gcgtcgacct gccgaccgtg       420
     gtgatcccgg tcgggcccat ggtggtgggg caccacaagg gcgaagtgct cggcgcctgc       480
     acggattgcc gccgcctctg ggccgcccat cgggccggcg cgatcgacga gcaggagatc       540
     gagatggtga acgggcgcct cgcgccctcc gtcggcacct gcatggtgat gggcacggcc       600
     tccaccatgg cctgcctcac cgaggcgatg ggtctgtcgc tgccgctctc ggcgacgatt       660
     cccgcccctc atgcggagcg cgtgcgcctc gccgaggcga gcgggcggcg tgcggccgag       720
     atggcggtcg ccggggggcc gcgtccgagc gccatcctga cgccggccgc cttccgcaac       780
     gcgcagaccg tgctccaggc gatcggcggc tcgacgaacg ggctcatcca cctcacggcc       840
     atagccaggc gcgtccgcgc cgagatcgac ctcgacgcct tcgacgcgat cggccgcgcg       900
     gtgccggtgc tggtcgacct caaaccctcg ggcgaccact acatggagca tttccaccat       960
     gcgggcgggg tgccccgcct gcttgcggaa ctcggcgacc tcatcgacct cgacgtgccg      1020
     accgtggcgg gagaaaaact gcgcgacgtc gtggcggcgg ccgagattgt gccgggccag      1080
     accgtcatcc gcagccctgc cgatccgatc aagccgacgg gcgggctcgc cgtgctgcgc      1140
     ggcaacctcg cgccccgggg cgcgctcatc aagcacgcgg cggcgagcga gcgcctcctc      1200
     cagcacacgg ggcgggcgct ggtgttcgaa tcgatccccg agatggccgc gcggatcgac      1260
     gacccggatc tcgacgtctc gcccgacgac gtgctggtgc tgtgcaatgc cggtcccaag      1320
     ggggcgcccg gcatgccgga ggcgggctac ctgccgatcc ccaagaagct cgctcgccag      1380
     ggcgtgaagg acatggtgcg catctcggat gcgcggatga gcggcacggc cttcggcacg      1440
     atcgtgctgc acgtcacccc ggaatccgcg gtgggcggcc cgctcgccct ggtgcggacc      1500
     ggcgacagga tccgcctcga cgtggccggg cggcgcatcg acctcctggt ggacgaggcg      1560
     gaactcgccc ggcgcgcggc ggcgctgccg gcgccgccgc ggcccgcctg ggccgagcgg      1620
     ggctatgccc gcctgttcca cgacacggtc acgcaggcgg acgagggctg cgacttcgat      1680
     ttcatgcggc cgggcggggc tgctcaggga aactga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page