(data stored in ACNUC7421 zone)

EMBL: CP001349.PE445

CP001349.PE445       Location/Qualifiers
FT   CDS_pept        511130..511813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55497"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA9"
FT                   /inference="similar to AA sequence:KEGG:M446_2012"
FT                   /protein_id="ACL55497.1"
FT                   /translation="MKSSSILAAVTLLLAAPPAFSQGTAEQRAACTPDVWRLCASAIPN
FT                   VGAITSCLRRESANLSPACRTVMNEVQGPAQRVESAQRVAPARPEAPQRMATRRQEPPR
FT                   IAVHPAPVRRTLAARPAPRMMTPRQAPVRLTMRRHYARTAMVRHPAVHAATPRRHYAVR
FT                   SPRRDYAGIPAGFARFGGSRSAMREANYWMRQISGMMGGMGGMGGMSLDSIRDMRVGDL
FT                   MNMME"
     atgaagtcct cttcgatcct cgcagcggtc acgctgctgc tcgcggcgcc gccggccttc        60
     tcccagggca cggcggagca gcgggccgcc tgcacgccgg atgtctggcg tctgtgtgcc       120
     tcggcgatcc ccaatgtcgg cgcgatcacg tcgtgcctgc ggcgggaatc cgccaatctc       180
     agcccggcct gccgcacggt gatgaacgag gtccaggggc ccgcccagcg ggtggaatcc       240
     gcccagcggg tggcgcccgc ccggccggag gcgccccagc ggatggcgac gcggcgtcag       300
     gagcccccgc ggattgccgt gcatcccgcg cccgtccggc ggaccctggc ggctcgtccg       360
     gcgccacgga tgatgacgcc ccgtcaggcg ccggtgcgct tgacgatgcg gcgccactat       420
     gcccgcaccg cgatggtgcg ccacccggcc gtccatgcag ccacgccgcg gcggcactat       480
     gccgtgcggt ccccgcggcg cgactatgcg ggcatcccgg cgggcttcgc cagattcggc       540
     ggcagccgtt ccgccatgcg ggaggccaat tactggatgc gccagatcag cggcatgatg       600
     ggtgggatgg gaggcatggg cgggatgtcc ctcgactcca tccgcgacat gcgcgtcggc       660
     gacctcatga acatgatgga gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page