(data stored in ACNUC7421 zone)

EMBL: CP001349.PE447

CP001349.PE447       Location/Qualifiers
FT   CDS_pept        512244..513281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0457"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: met:M446_2010 Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55499"
FT                   /db_xref="GOA:B8ICB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB1"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACL55499.1"
FT                   /translation="MATPTATPRLLCDEPALPGLLFAMVFDETGRGRLVRHDEEVPAPG
FT                   SFGEGFLWLHLNLADARIEGLIAEGRLGPPRLASSAFARDEHQRIAVEGGFVGGVVADL
FT                   AREEAATKPNPAGRLHFVMGPRFLVSGRRHPVVGPDRTRQAAAEGETITAPVRLLESLV
FT                   GHVVGAMAATGAALSDELDAIEDHILDEAVRDERRRLGPIRRDAVRLHRQLLGLRAAFH
FT                   RFEEEGEAEGLPDREVATAARIAQRLDSLDRDMLAMAERSRLLQEEFAARLAEQSNRQL
FT                   FTLSVLTALFLPPTLVTGVFGMNTKGLFLSDFEEGSTIALALAVASALAVYLVIRSLGL
FT                   RTPRR"
     gtggcgacgc ccaccgccac gccgcggctc ctctgcgacg agccggccct gccgggcctg        60
     ctcttcgcca tggtcttcga cgagacgggc aggggccgcc tcgtccggca cgacgaggag       120
     gtgccggcgc ccggcagctt cggcgagggc ttcctgtggc tgcacctcaa ccttgcggat       180
     gcccgcatcg agggcctgat cgcggagggg cggctcgggc cgccgcggct cgcttcctcg       240
     gccttcgcgc gcgacgagca ccagcgcatc gccgtcgagg gcggcttcgt cggcggtgtc       300
     gtggccgacc tcgcccggga ggaggcggcg acgaagccga acccggcggg ccgcctgcac       360
     ttcgtgatgg ggccgcgctt cctcgtgagc gggcgccgcc atcccgtggt cgggccggac       420
     cgcacgcgtc aggccgccgc ggagggcgag accatcacgg cgccggtgcg cctgctcgaa       480
     tccctcgtcg gccacgtggt cggcgccatg gcggcgacag gcgcggcgct ctcggacgag       540
     ctcgacgcca tcgaggatca tatcctggac gaggccgtgc gcgacgagcg gcgtcgcctc       600
     ggcccgatcc gccgcgacgc ggtgcggctg caccggcagc tcctggggct gcgcgccgcc       660
     tttcaccgct tcgaggaaga gggggaagcc gaagggctcc ccgaccgtga ggtcgccacg       720
     gcggcccgca tcgcccagcg cctcgattcg ctcgaccgcg acatgctggc gatggcagag       780
     cgcagccgcc tcctccagga ggagttcgcg gcgcggctcg ccgagcagtc caaccgccag       840
     ctcttcaccc tctcggttct caccgcgctg ttcctgccgc cgaccctcgt cacgggcgtc       900
     ttcggcatga acaccaaggg cctgttcctg tcggacttcg aggagggctc gaccattgcc       960
     ctcgccctcg cggtcgcctc ggcgctcgcg gtctatctcg tgattcgcag cctcgggctg      1020
     cgcacgccgc gccgctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page