(data stored in ACNUC7421 zone)

EMBL: CP001349.PE448

CP001349.PE448       Location/Qualifiers
FT   CDS_pept        513469..514146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55500"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB2"
FT                   /inference="similar to AA sequence:KEGG:M446_2009"
FT                   /protein_id="ACL55500.1"
FT                   /translation="MPDGCRDEAGAQQLGFSAFPEGTSRVSTIMRAILLGLAALAVAAG
FT                   HPVQAADLAAPVPAPDYHPPVQPLSIVSELRIGGSVQDPWSPESGSGNVTGEVLLAKPT
FT                   LTPDPFWNQFIPRPTVGGSYNTAGRTSYAYLGATWTFDITERFFVEGFFGASFHNGATG
FT                   RFVPPGFNALGCSPLFREAGSVGFRITEHWSVLATIEHQSNAGLCVANRGLTNVGGKIA
FT                   YTF"
     atgccggatg gctgccgaga cgaagcagga gcgcagcagc taggcttcag cgcgttcccg        60
     gaaggaacgt ctcgggtctc aaccatcatg cgtgccattc tcctgggtct agcggcgctc       120
     gcggtcgcgg ccggccatcc tgtccaggcc gccgatctcg cggcgccggt tccggctccg       180
     gactaccatc cgcccgtgca gccgctcagc atcgtgtcgg agctgcgcat cggcggctcc       240
     gtccaggatc cctggagccc cgagagcggc agcggcaacg tcacgggcga ggtcctgctc       300
     gccaagccga ccctcacgcc ggacccgttc tggaaccagt tcatcccgcg cccgaccgtg       360
     ggcggcagct acaacacggc cggtcgcacc agctacgcct atctgggcgc gacctggacc       420
     ttcgacatca ccgagcggtt cttcgtcgaa ggcttcttcg gcgcctcgtt ccacaacggc       480
     gcgacgggcc gcttcgtccc gccgggcttc aacgcgctcg gctgctcgcc gctcttccgc       540
     gaggcgggct cggtcggctt ccgcatcacc gagcactgga gcgtgctcgc cacgatcgag       600
     caccagtcca atgccggcct ctgcgtggcg aaccgcggcc tgaccaatgt cggcggcaag       660
     atcgcctaca cgttctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page