(data stored in ACNUC7421 zone)

EMBL: CP001349.PE449

CP001349.PE449       Location/Qualifiers
FT   CDS_pept        514258..514833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0459"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: met:M446_2008
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55501"
FT                   /db_xref="GOA:B8ICB3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB3"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACL55501.1"
FT                   /translation="MVVLNRIYTRTGDTGTTALASGERRSKADLRIETYGTVDETNACV
FT                   GLARQHSTGDLDAMLSRIQNDLFDLGADLATPESDTPPAYEPLRIVPEQVERVEREIDA
FT                   LNAGLQPLRSFVLPGGTAAAAALHLARTVCRRAERLAVALAATPGERVSPVAIQYLNRL
FT                   SDFLFVASRVANDGGAKDVLWVPGKNRG"
     gtggtcgtcc tcaaccgcat ctacacccgc accggcgata ccggcaccac cgcgctggcg        60
     agcggcgagc gccgctccaa ggcggatctg cgcatcgaga cctacggcac cgtcgacgag       120
     accaatgcct gcgtgggcct cgcccgccag cacagcaccg gcgatctcga cgcgatgctc       180
     tcgcgcatcc agaatgatct cttcgacctc ggcgccgacc tcgccacgcc cgagagcgac       240
     accccgcccg cctacgagcc cctgcgcatc gtgccggagc aggtcgagcg ggtggagcgg       300
     gagatcgacg cgctcaatgc cggcctccag ccgctgcgct ccttcgtgct gcccggcggg       360
     accgcggcgg cggcggcact ccacctcgcc cgcacggtct gccgccgggc cgagcggctg       420
     gccgtggcac tcgccgcgac ccccggcgag cgggtctcgc cggtggcgat ccagtacctc       480
     aaccgcctgt ccgacttcct gttcgtcgcc tcccgggtcg ccaatgacgg cggggccaag       540
     gacgtgctct gggtgcccgg caagaaccgg gggtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page