(data stored in ACNUC7421 zone)

EMBL: CP001349.PE45

CP001349.PE45        Location/Qualifiers
FT   CDS_pept        complement(50375..52192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0046"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: met:M446_0046 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55097"
FT                   /db_xref="GOA:B8IU52"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU52"
FT                   /inference="protein motif:PFAM:PF03445"
FT                   /protein_id="ACL55097.1"
FT                   /translation="MQTFDVLNPPFDRLTAAEADSLRRHVDVGYFRPGTVIVTQGKEAD
FT                   LLHVVIKGAVEARNQGALLAVLRAGDTFDARAVVHGEAGENFVAAEETLCFLIPREVIV
FT                   RLVHANSAFAAFFYAEISRKLDALASWQRRESMDSVLRTRIRDARHAPAVFLSGGSTLE
FT                   EAARRMLAADVDAVFVEDAGRTGLLTGHKVTRAAVIEHRPFDTPVRDLAKFDVTAVEAD
FT                   QFLLDALLVMTRHGNRRIAVRQDGAYVGWLRDIDLLGAFAGNAQLVPSRIDRAASIEDL
FT                   REPARDIQAQGQQLHRQGVRVDAVAQVISDLNRRLYARLFALLAPAAIREAGCLFLMGS
FT                   EGRGEQTYRTDQDNGLILSRPVPQAELADFRDAFSAALGELGYPPCPGEIMVRNPLWSQ
FT                   EADHFVNQLRLWAQAGDPDAAMNLAIFADATAVAGDPAPLQRAKTFLTEAVRGETRLLA
FT                   QIANLINIAGDAANGGLVDAVFSRVGLRRNELDLKRAGLFPLVHGVRVLAIEAGIAPTG
FT                   TVERIRALTQGGILEEGFGRDLASALLALMGLRFDRQLAAAQRGQGLGPVILDFDAMPT
FT                   LERDLLRDSLRIVRRLREVIHVRYALGQF"
     gtgcagacct tcgacgtcct caaccctccc ttcgaccgcc tcactgccgc ggaggcggac        60
     agcctgcgcc gccacgtcga tgtcggctat ttccggcccg ggacggtcat cgtgacgcag       120
     ggcaaggagg cggacctcct gcacgtcgtg atcaaggggg cggtggaggc acgcaaccag       180
     ggcgcactcc tggcggtgct gcgggccggc gacaccttcg atgcccgcgc ggtggtgcac       240
     ggggaggcgg gcgagaactt cgtcgccgcc gaggagacgc tgtgcttcct gatcccgcgg       300
     gaggtgatcg tccggctcgt ccacgccaac agcgccttcg cggccttctt ctacgcggag       360
     atctcccgca agctcgacgc gctcgcctcc tggcagcggc gcgagagcat ggattcggtg       420
     ctgcgcacgc gcatccgcga cgcgcgccac gcgccggccg tcttcctgtc cggcggctcc       480
     accctggagg aggccgccag gcggatgctc gcggcggatg tcgacgccgt cttcgtggag       540
     gatgccggcc gcaccggcct gctcaccggg cacaaggtga cgcgcgcggc ggtgatcgag       600
     caccggccgt tcgacacgcc cgtgcgcgac ctcgcgaaat tcgacgtgac cgccgtcgag       660
     gccgaccagt tcctgctcga tgcgctcctc gtcatgacgc gccacggcaa ccggcggatc       720
     gcggtgcgcc aggacggcgc ctatgtgggc tggctgcgcg acatcgacct tctcggcgcc       780
     ttcgcgggca acgcgcagct ggtgccgagc cgcatcgacc gggcggccag catcgaggat       840
     ctgcgcgagc ccgcgcgcga catccaggcg cagggccagc agctgcaccg ccagggcgtg       900
     cgcgtcgacg cggtggcgca ggtgatctcg gacttgaacc ggcggctcta tgccaggctg       960
     ttcgcgctcc tcgccccggc ggcgatccgc gaggccggat gcctgttcct gatgggctcg      1020
     gagggccgcg gcgagcagac ctaccgcacc gaccaggaca acggcctcat cctctcccgc      1080
     ccggtgccgc aggccgagct ggcggacttc cgcgacgcct tctcggcggc gctcggcgag      1140
     ctcggctatc cgccctgtcc gggcgagatc atggtgcgca acccgctctg gtcgcaggag      1200
     gccgaccact tcgtgaacca gctgcgcctg tgggcgcagg ccggggatcc ggacgctgcg      1260
     atgaatctcg cgatcttcgc ggatgcgacc gccgtcgcgg gcgatcccgc cccgctgcag      1320
     cgggccaaga ccttcctcac cgaagcggtg cggggcgaga cgcggctgct ggcgcagatc      1380
     gccaacctga tcaacatcgc gggcgacgcc gcgaacgggg gcttggtcga cgcggtcttc      1440
     tcccgggtcg gcctgcggcg caacgaactc gacctcaagc gggcgggcct gttcccgctc      1500
     gtgcacgggg tgcgggtgct cgccatcgag gcgggcatcg ccccgaccgg caccgtcgag      1560
     cgcatccgcg ccctcacgca gggcgggatc ctggaggagg ggttcgggcg cgacctcgcg      1620
     agcgcgctgc tcgccctgat gggcctgcgc ttcgaccggc agctcgccgc cgcccagcgc      1680
     gggcaggggc tcggtcccgt gatcctcgac ttcgacgcga tgccgaccct ggagcgggat      1740
     ctcctgcgcg actcgctgcg catcgtgcgc cgcctgcgcg aggtgatcca cgtccgttac      1800
     gcgctcgggc agttctga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page