(data stored in ACNUC7421 zone)

EMBL: CP001349.PE450

CP001349.PE450       Location/Qualifiers
FT   CDS_pept        515064..515813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0460"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: met:M446_2007 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55502"
FT                   /db_xref="GOA:B8ICB4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB4"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACL55502.1"
FT                   /translation="MKVLVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVEE
FT                   AIRLKEKAKVSEIVAVSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLRAL
FT                   VDKEQPQLVILGKQAIDDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREIDGGL
FT                   QTLTLALPAIVTTDLRLNEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVLKTVE
FT                   PGGRQAGVKVASAAELVSKLKGEAGVL"
     atgaaggttc tggtgcccgt gaagcgggtg gtcgactaca acgtgaagat ccgggtgaag        60
     ccggacggct cgggcgtcga cctcgccaac gtcaagatgg ccatgaaccc cttcgacgag       120
     atcgccgtcg aggaggccat ccggctgaaa gagaaagcca aggtcagcga gatcgtcgcc       180
     gtctcgatcg ggccgcaaca ggcccaggag acgctgcgca ccgcgctcgc catgggtgcc       240
     gatcgcggca tcctggtcag gaccgacgcc cccgtcgagc cgctcgccgt cgccaagctc       300
     ctccgggccc tggtcgacaa ggagcagccc cagctcgtca tcctcggcaa gcaggccatc       360
     gacgacgatg ccaaccagac cggccagatg ctcgccgccc tgctcggctg gccgcaaggc       420
     accttcgcct accggatcga gctcggcgag ggcagcctcg aggtcacccg cgagatcgac       480
     ggcggcctgc agacgctgac gctggcgctg ccggcgatcg tcaccacgga tctgcgcctc       540
     aacgagccgc gctacgccag cctgcccaac atcatgaagg ccaagaagaa gcccctcgac       600
     accctcgagc cggcggcgct cggggtcgat gtcgcgccgc ggctgaaggt gctcaagact       660
     gtcgagccgg gcggccgcca ggccggggtc aaggtcgcct cggcggccga actcgtcagc       720
     aagctgaagg gcgaggccgg cgtcctctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page