(data stored in ACNUC7421 zone)

EMBL: CP001349.PE451

CP001349.PE451       Location/Qualifiers
FT   CDS_pept        515845..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0461"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: met:M446_2006 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55503"
FT                   /db_xref="GOA:B8ICB5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB5"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACL55503.1"
FT                   /translation="MATLLLVEHAHGAPKDGSLKALTAARQLGAPVHALVTGAGSRPAA
FT                   EATARLEGVEKVLLAENAAFDHLLAEPTAALLAELAAGYDAVIAAASTEGKNVLPRVAA
FT                   LLDVAQVSDITKVVAPDTFERPIYAGNAIQTVQVSEPKKVITVRTAAFKAAEAGGAPAP
FT                   IEAAAAAVAPEVKSAFKGEEIAQSDRPELASARIVVSGGRSLGSAEKFRELIEPLADAL
FT                   GAAVGASRAAVDAGYAPNDWQVGQTGKVVAPDLYVAVGISGAIQHLAGMKDSKVIVAIN
FT                   KDEEAPIFQVADYGLVGDLFQIVPELQQEIAKAKG"
     atggccaccc tgcttctcgt cgagcacgcc cacggcgcgc ccaaggacgg ttccctgaag        60
     gcgctcaccg ccgcccggca gctcggcgcc ccggtccacg ccctggtgac cggcgccggc       120
     agccggccgg cggccgaggc caccgcccgg cttgagggtg tcgaaaaagt gctgctggcc       180
     gagaacgccg ccttcgacca cctgctggcc gagccgaccg cggcgctgct tgccgagctg       240
     gcggcgggct acgacgcggt gatcgcggcg gcgagcaccg agggcaagaa cgtgctgccg       300
     cgcgtcgccg cgctgctcga cgtggcgcag gtctcggaca tcaccaaggt ggtggcgccc       360
     gacaccttcg agcggccgat ctatgccggc aacgcgatcc agaccgtgca ggtgagcgag       420
     ccgaaaaagg tgatcacggt gcgcaccgcc gccttcaagg cggccgaggc gggcggcgcg       480
     ccagccccga tcgaggcggc ggcagcggca gtggcgccgg aggtgaagtc ggcgttcaag       540
     ggcgaggaga tcgcccagtc ggaccggccg gagctggcct cggcccggat cgtggtgtcg       600
     ggcgggcgct cgctgggctc ggcggagaag ttcagggagc tgatcgagcc gctggcggat       660
     gcgctggggg cggcggtggg ggcctcgcgg gcggcggtgg atgcgggcta cgcgccgaat       720
     gactggcagg tgggccagac cggcaaggtg gtggcgccgg atctctacgt ggcggtgggg       780
     atctcggggg cgatccagca tctggcgggg atgaaggatt ccaaggtgat cgtggcgatc       840
     aacaaggacg aggaggcgcc gatctttcag gtggcggatt acggcctggt cggcgacctg       900
     ttccagatcg tgcccgagct ccagcaggag atcgccaagg ccaagggctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page