(data stored in ACNUC7421 zone)

EMBL: CP001349.PE452

CP001349.PE452       Location/Qualifiers
FT   CDS_pept        516965..517846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0462"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   met:M446_2005 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55504"
FT                   /db_xref="GOA:B8ICB6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACL55504.1"
FT                   /translation="MGIEIKTVGIIGAGQMGSGIAHVCAVSGLDVRLNDRDPERLKNGL
FT                   ATVNGNLQRQVAKGTITEEARRAAIERIQPVESFDEFTPCDLVIEAATEDEAIKRNIFS
FT                   ALCPSLRPETMVATNTSSISITRLAASTDRPERFIGIHFMNPVPVMQLVELIRGIATED
FT                   PTFESARTFVNRLGKTVTVSEDFPAFIVNRILLPMINEAIYTLYEGVGSVDSIDTAMRL
FT                   GANHPMGPLQLADFIGLDTCLSIMQVLYEGLADSKYRPCPLLVKYVEAGWLGRKSKRGF
FT                   YDYRGPEPVPTR"
     atgggcatcg agatcaagac tgtcgggatc atcggggccg gccagatggg cagcggcatc        60
     gcgcatgtct gcgccgtctc gggcctcgac gtgcgcctca acgaccggga tccggagcgc       120
     ctcaagaacg ggctggcgac ggtgaacggc aacctgcagc gtcaggtcgc caagggcacc       180
     atcacggagg aggcgcgccg ggccgcgatc gagcggatcc agccggtcga gagcttcgac       240
     gagttcaccc cctgcgacct cgtcatcgag gcggcgactg aggacgaggc gatcaagcgc       300
     aacatcttct cggcgctgtg cccttcgctg cggcccgaga cgatggtggc gaccaacacc       360
     tcgtcgatct cgatcacgcg gctggccgcc tcgaccgacc ggcccgagcg cttcatcggc       420
     atccacttca tgaatccggt gccggtgatg cagctcgtcg agctgatcag gggcatcgcc       480
     acggaggacc cgaccttcga gtcggcccgg accttcgtga acaggctcgg caagacggtg       540
     acggtgtccg aggatttccc ggccttcatc gtcaaccgca tcctgctgcc gatgatcaac       600
     gaggcgatct atacgctcta cgagggcgtc ggctcggtgg attccatcga cacggcgatg       660
     cgtctcggcg ccaaccatcc gatggggccg ctgcagctcg ccgacttcat cggcctcgac       720
     acctgcctgt cgatcatgca ggtgctctac gagggcctgg cggattcgaa gtaccgcccc       780
     tgcccgctcc tggtgaaata cgtcgaggcc gggtggctcg gccgcaagtc gaagcgcggc       840
     ttctacgatt atcgcgggcc cgagccggtc ccgacccgct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page