(data stored in ACNUC7421 zone)

EMBL: CP001349.PE453

CP001349.PE453       Location/Qualifiers
FT   CDS_pept        complement(517911..518225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55505"
FT                   /db_xref="GOA:B8ICB7"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB7"
FT                   /inference="similar to AA sequence:KEGG:M446_2004"
FT                   /protein_id="ACL55505.1"
FT                   /translation="MAIDDRRVETTTEARQGTKGKPVLYVLLGSLALLVIAAVALLTWN
FT                   GANSPKDYASQSQDASRAQITGSAGGKGNVTNPSSHVPAGNPAYPQPSQPTTTGSTNPR
FT                   "
     atggccatcg acgaccgtcg ggtcgagacg acgaccgaag cccgccaggg caccaagggc        60
     aagcccgtcc tctacgtgct cctcggcagc ctcgcgctcc tggtgatcgc ggccgtggcg       120
     ctcctgacct ggaatggtgc gaactcgccc aaggactatg ccagccagag ccaggacgcc       180
     tcgcgcgccc agatcaccgg ctcggccggc ggcaagggca acgtgaccaa cccgagcagc       240
     cacgtgccgg ccggcaaccc ggcctatccg cagccgtccc agcccaccac gaccggttcg       300
     accaacccgc ggtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page