(data stored in ACNUC7421 zone)

EMBL: CP001349.PE454

CP001349.PE454       Location/Qualifiers
FT   CDS_pept        complement(518323..519330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0464"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_2003 PIG3 family NAD(P)H quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55506"
FT                   /db_xref="GOA:B8ICB8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB8"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACL55506.1"
FT                   /translation="MPALPDTMRQVRFNGAGGPEVIGIETAPVPKPGPGQVLIEVVAAG
FT                   VNRPDCQQRAGKYPPPPGATDVPGLEVAGRIAALGEGVTGLAVGDEVCALVISGGYAEF
FT                   CLAEAPLCLPKPGPLSLIEAAGLPENYYTVWTNVFERGRLQKGERFLVHGGSSGIGYTA
FT                   IQLAKHFGATVYATAGSADKCAFCERMGADVAINYRETDFAEEVKRLTDGKGVDVILDM
FT                   VGASYLERNLKSLALEGRLVVIAFLQGFKVESFNMTPIMVKRLTFTGSTLRPRTTAQKA
FT                   AIAEGLRREVWPLLESGALKAVIHATFPLEQAREAHALMESSAHLGKIMLTTGR"
     atgcccgccc ttcccgacac catgcgccag gtccgcttca acggggccgg cgggccggag        60
     gtgatcggca tcgagaccgc gccggtgccg aagcccgggc cgggtcaggt gctgatcgag       120
     gtcgtggcgg cgggcgtgaa ccgcccggat tgccagcagc gcgccggcaa gtatccgccg       180
     ccgcccggtg ccaccgacgt cccggggctc gaggttgcgg gccgcatcgc ggctctcggc       240
     gagggggtga ccggcctcgc cgtgggcgac gaggtctgcg ccctcgtcat cagcggcggc       300
     tacgccgagt tctgcctcgc cgaggcgccg ctgtgcctgc cgaagcccgg cccgctctcg       360
     ctgatcgaag ccgcgggcct gccggagaac tactacacgg tctggaccaa cgtgttcgag       420
     cgcgggcgcc tgcagaaggg cgagcgcttc ctcgtccatg gcgggtcgag cggcatcggc       480
     tacacggcga tccagctcgc caagcatttc ggcgcgaccg tctacgccac ggccggctcg       540
     gcggacaaat gcgccttctg cgagcggatg ggcgcggacg tggcgatcaa ctaccgggag       600
     accgacttcg ccgaggaggt gaagcgcctc acggacggca agggcgtcga cgtgatcctc       660
     gacatggtcg gggcctccta tctggagcgc aacctgaagt ccctggcgct ggagggccgc       720
     ctcgtcgtca tcgcgttcct gcagggcttc aaggtcgagt ccttcaacat gaccccgatc       780
     atggtgaagc gcctgacctt cacgggctcg accctgcgcc cccgcaccac cgcccagaag       840
     gcggccatcg cggaggggct gcgccgggag gtctggccgc tcctggaatc cggagcgctc       900
     aaggccgtga tccacgccac cttcccgctg gagcaggcgc gggaggccca tgcgctcatg       960
     gaatcgagtg cgcatctcgg caagatcatg ctgaccaccg gtcgatag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page