(data stored in ACNUC7421 zone)

EMBL: CP001349.PE455

CP001349.PE455       Location/Qualifiers
FT   CDS_pept        complement(519442..520104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0465"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_2002 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55507"
FT                   /db_xref="GOA:B8ICB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB9"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ACL55507.1"
FT                   /translation="MQGASTRETTGAAPVTVVSHPLVQHKLTLMRDKARSTKGFRQLLN
FT                   EIGTLLAYEVTRDLPLEPIEVETPLVTMQGVQIAGKKLVLAPILRAGIGFLDGMLSLVP
FT                   SARVAHVGLYRDPDSLQAVEYYFKAPSDLADRTVLVLDPMLATANSAIAAVDRLKERGA
FT                   RDLRIVCLIAAPEGLAKFRGAHPDVPVWTAAIDSHLDEHGYIIPGLGDAGDRMYGTR"
     atgcagggtg cgagcacgcg ggagacgacg ggagccgcgc cggtcacggt cgtctcccat        60
     ccgctggtgc agcacaagct gacgctgatg cgggacaagg cgcgctcgac caagggcttc       120
     cgccagctgc tgaacgagat cggcacgctg ctcgcctacg aggtgacgcg cgacctgccg       180
     ctggagccga tcgaggtcga gacgcccctc gtgaccatgc agggggtgca gattgccggc       240
     aagaagctcg ttctggcacc gatcctgcgc gccggcatcg gcttcctcga cggcatgctc       300
     tctctcgtgc cctcggcccg cgtcgcccat gtgggcctct accgcgatcc ggactcgctc       360
     caggccgtcg agtactactt caaggcgccg tccgatctcg ccgaccgtac ggtgctggtc       420
     ctcgacccga tgctcgctac cgccaattcg gccattgcgg cggtggaccg gctgaaggag       480
     cgcggcgccc gcgacctgcg catcgtctgc ctgatcgccg cgccggaggg cctggcgaag       540
     ttccggggcg cgcatcccga cgtgccggtc tggaccgccg ccatcgacag ccacctcgac       600
     gagcacggct acatcatccc cgggctcggg gatgccggcg accggatgta cgggacgcgc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page