(data stored in ACNUC7421 zone)

EMBL: CP001349.PE456

CP001349.PE456       Location/Qualifiers
FT   CDS_pept        complement(520156..521412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0466"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bra:BRADO1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55508"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC0"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ACL55508.1"
FT                   /translation="MSVPQDRNETPSVQDARWLLTPEAVRARAEGLLALGLDGGLEHFA
FT                   VHPDRLGPCADAVVETIRAAYPDLDIPYHARWRHFSVGGFDRWGSLLQAASWEDVAARA
FT                   RAAFDLVIVSVLLDAGAGPTWRYEEGRTGETYARSEGLAVASFDLFISGLFSEAPEDPF
FT                   RVDARALASLTVADLAQGFQVTPTNPLVGLEGRTALLNRLGQVVAADPDGFGPEARPGG
FT                   LYDRLAARATDGALPATAILSALLAHLGPIWPGRITLDGVDLGDTWRHSRAGGEGETAG
FT                   LVPFHKLSQWLAYSLLEPLEEAGLTVTGLDALTGLPEYRNGGLFLDTGVLTLKRPEEAS
FT                   RAHPVESELVVEWRALTVALLDRLAPLVRERLGIGDPADLPLAKVLEGGTWATGRRLAR
FT                   ALRPDGTPPLAIASDGTVF"
     gtgagcgtgc cgcaggacag aaatgaaacc ccgtccgttc aggacgcccg ctggctcctc        60
     accccggagg cggtgcgcgc gcgggccgag ggtctgctcg ccctcggcct cgacgggggc       120
     ctcgagcact tcgccgttca tccggacaga ctcggtcctt gcgcggacgc ggtggtcgag       180
     accatccgcg ccgcctatcc ggacctcgac atcccctatc acgcccgctg gcggcacttc       240
     tccgtcggcg gcttcgaccg ctggggcagc ctcctgcagg cggcgtcctg ggaggacgtg       300
     gccgcgcggg cgcgggcggc cttcgacctc gtgatcgtca gcgtgctgct tgatgcgggc       360
     gccggcccga cctggcgcta cgaggagggc cgcacgggcg agacctatgc gcgctcggaa       420
     gggctcgcgg tggcgagctt cgacctcttc atctccggtc tgttctcgga ggcgccggag       480
     gatcccttcc gggtcgatgc gcgggcgctc gcgagcctga ccgtcgccga tctcgcccag       540
     ggcttccagg tcacgccgac gaacccgctc gtcggcctgg aggggcgcac cgcgctgctc       600
     aaccggctgg gtcaggtcgt cgccgcggat ccggacgggt tcggtcccga ggcgcgcccg       660
     ggcgggctct acgaccgcct cgccgcacgg gcgacggacg gcgcgctgcc cgcgaccgcg       720
     atcctctccg cgctcctcgc ccatctcggc ccgatctggc ccggccgcat caccctcgac       780
     ggggtcgatc tcggcgacac ctggcgccat tcccgcgccg gaggggaggg ggagacggcg       840
     gggctcgtgc cgttccacaa gctgtcgcag tggctcgcct actcgctgct ggagcctctg       900
     gaggaggcgg gcctgaccgt gaccggcctc gacgcgctca cgggcctgcc ggaataccgc       960
     aatggcggcc tcttcctcga caccggcgtg ctgacgctca agcggcccga agaggcgtcg      1020
     cgggcgcatc cggtcgagtc cgagctcgtg gtcgagtggc gcgccctgac ggtggcgctc      1080
     ctcgaccggc tggcgccgct cgtgcgcgag cgcctcggga tcggcgaccc ggccgacctg      1140
     ccgcttgcca aggtgctgga gggcgggacc tgggcgacgg gccggcggct cgcccgggcc      1200
     ctgcggccgg acgggacgcc gccgctcgcc atcgcgagcg acggcacggt gttctaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page