(data stored in ACNUC7421 zone)

EMBL: CP001349.PE457

CP001349.PE457       Location/Qualifiers
FT   CDS_pept        complement(521693..522949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55509"
FT                   /db_xref="GOA:B8ICC1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC1"
FT                   /inference="similar to AA sequence:KEGG:M446_2000"
FT                   /protein_id="ACL55509.1"
FT                   /translation="MTTSNRSTHIRLTSHPEPRAARWPIRWGAADPRERGPVIGTVTNP
FT                   ADRNVIGANGGAYSLYRALAIAGRALNPLARPDLTNTHPVVPIGPHPQWAEPDRIVSLD
FT                   PWGHLPGEIFAREIATGTDIRPTIAVTKARLGLPEILAAIGAHRLAPDGSILHASGDIA
FT                   VTKIAIDPVWYLPGVAARFGTTETALRRTLFEQTGGMFPELVTRPDMQVFLPPIGGCTV
FT                   YIMGDAARIAEPGTRIACRVHDECNGSDVFGSDICTCRPYLTHGIEECVREAQGGGVGV
FT                   IVYNRKEGRALGEVTKFLVYNARKRQEGGDSAATYFERTECVAGVQDARFQQLMPDVLH
FT                   WLGIRRIDRLMSMSNMKYDAITGSGIEVGERVPIPPELIPPDAAVEIEAKKAAGYYTPG
FT                   EAPDAAALDTVKGRDLDRF"
     atgaccacat ccaaccgctc gacgcatatc cggctcacct cgcatcccga gccgcgcgcc        60
     gcccgctggc cgatccgctg gggcgcggcc gacccgcgcg agcgcgggcc cgtcatcggt       120
     acggtcacca acccggccga ccgcaacgtg atcggggcga atggcggcgc ttattcgctc       180
     taccgggcgc tcgcgatcgc cggccgcgcc ctcaatcccc tggcgcggcc cgacctcacc       240
     aacacgcatc cggtggtgcc gatcggtccg cacccgcaat gggcggagcc cgaccggatc       300
     gtctcgctcg atccctgggg tcacctgccg ggcgagatct tcgcccgcga gatcgccacc       360
     ggcaccgaca tccgtccgac catcgcggtc accaaggccc ggctcggcct gcccgagatc       420
     ctggcggcga tcggtgccca tcgcctcgca cccgatggca gcatcctgca cgcgagcggc       480
     gacattgcgg tcaccaagat cgcgatcgac ccggtctggt acctgccggg cgtggctgcg       540
     cgcttcggca ccaccgagac ggcgctccgc cgcaccctgt tcgagcagac gggcggcatg       600
     ttcccggaac tcgtcacccg gcccgacatg caggtcttcc tgccgccgat cggcggctgc       660
     acggtctaca tcatgggcga cgccgcgcgg atcgccgagc ccggtacccg catcgcctgc       720
     cgggtgcacg acgagtgcaa cggctcggac gtgttcggct cggacatctg cacctgtcgg       780
     ccctatctca cgcacggcat cgaggaatgc gtgcgcgagg cgcaaggggg cggcgtcggc       840
     gtgatcgtct acaaccgcaa ggaggggcgg gccctcggcg aggtgacgaa gttcctcgtc       900
     tacaatgcgc gcaagcggca ggaagggggc gattccgccg ccacctattt cgagcgcacc       960
     gaatgcgtgg cgggcgtgca ggacgcgcgc ttccagcagc tcatgcccga cgtgctgcac      1020
     tggctcggca tccgccgcat cgaccggctg atgtcgatgt ccaacatgaa gtacgacgcg      1080
     atcaccgggt cgggcatcga ggtcggcgag cgggtgccga tcccgccgga actgatcccg      1140
     cccgacgccg cggtcgagat cgaggccaag aaggcggcgg gctactacac gcccggcgag      1200
     gcgcccgatg ccgccgccct cgacacggtg aaggggcggg atctcgaccg gttctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page