(data stored in ACNUC7421 zone)

EMBL: CP001349.PE458

CP001349.PE458       Location/Qualifiers
FT   CDS_pept        complement(523080..523499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55510"
FT                   /db_xref="GOA:B8ICC2"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC2"
FT                   /inference="similar to AA sequence:KEGG:M446_1999"
FT                   /protein_id="ACL55510.1"
FT                   /translation="MTFSSAPWSNGRACRGAGPFPRRSLEIGAIVLGFIYVWPLAVAYV
FT                   VWKLMGYPAFDELKSFAERAFRGGFGGAGAFRPGTGNWAFEEYRQRELERLEEERRRLE
FT                   EESRAFAEFVEELKRARDREQFDAFMAKRRAGSNY"
     gtgaccttct cttccgcccc ctggtcgaac ggccgcgcct gccgcggcgc cggtccgttc        60
     ccgcgccgct ccctggagat cggcgcgatc gtcctcggtt tcatctatgt ctggccgctc       120
     gcggtcgcct acgtggtgtg gaagctcatg ggatatccgg ccttcgacga actgaaatcc       180
     ttcgccgagc gcgccttccg cggcggattt ggcggcgccg gggccttccg gccgggcacc       240
     ggcaactggg ccttcgagga gtatcgccag cgcgagctgg agcgcctgga ggaagagcgc       300
     cgccgcctcg aagaggagag ccgcgccttc gcggaattcg tcgaagagct gaagcgcgcc       360
     cgcgaccgcg agcagttcga cgccttcatg gccaagcgcc gcgccggctc gaactactga       420
//

If you have problems or comments...

PBIL Back to PBIL home page