(data stored in ACNUC7421 zone)

EMBL: CP001349.PE46

CP001349.PE46        Location/Qualifiers
FT   CDS_pept        complement(52331..52789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0047"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_0047 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55098"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU53"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55098.1"
FT                   /translation="MTRLYLEDLAPGQIYRSGELTVSAEAIKRFAAEYDPQPFHLDEAR
FT                   AEASFFGGLAASGWHTAALTMRLLVESGLPLAGGVIGAGMDELRWPRPLRPGETIRLES
FT                   EVLEVRPSRSRPMQGLAKVRTTTLNQQGEPVQVLVANLVVLRREPGEG"
     atgacacgcc tctatctcga agacctcgcc cccgggcaga tctatcgctc gggcgagctc        60
     accgtgtcgg cggaggcgat caagcgcttc gccgccgagt acgacccgca gcccttccac       120
     ctcgacgagg cccgggccga ggcctcgttc ttcggcgggc tcgcggcgag cggctggcac       180
     accgctgcgc tgaccatgcg cctcctcgtc gagagcgggc tgccgctcgc cggcggcgtc       240
     atcggggcgg gcatggacga gctgcgctgg ccgcgccccc tgcgccccgg cgagaccatc       300
     cgcctggaga gcgaggtgct ggaggtccgc ccctcccgct cgcgtcccat gcaggggctc       360
     gcgaaggtcc gcaccaccac gctcaaccag cagggcgagc cggtgcaggt gctggtcgcg       420
     aatctcgtgg tgctgcggcg cgagccgggc gaggggtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page