(data stored in ACNUC7421 zone)

EMBL: CP001349.PE460

CP001349.PE460       Location/Qualifiers
FT   CDS_pept        complement(523967..525382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0470"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1718 protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55512"
FT                   /db_xref="GOA:B8ICC4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC4"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACL55512.1"
FT                   /translation="MRLPTRLALVAALALGPAAAVADPAPPTRALPESRGQVQLSFAPL
FT                   VRRAAPSVVNVYGAHVERRSANRNAMDEFLRRFFGETGPGGTQERAQRSLGSGVIVDAA
FT                   GLIVTNNHVIENMNEVKVALSDRREFPAEIVLRDPRTDLAVLRIKAPGGLSAMEFGDSE
FT                   GLQVGDFVLAIGNPFGVGQTVTQGIVSALARTQVGSADYQFFIQTDAAINPGNSGGALV
FT                   DLNGQLVGINTAIFSQSGGSHGIGFAIPASMVKAVVETAKGGGRLVRRPWLGARLQNVT
FT                   PDIADSVGLDHPTGVLVASMVAKSPAEEAGLKRGDVILSVDDRPVDDPEAFGYRFALKG
FT                   ISGETKLAVLRGSNRITVPVRLAPAPETRPRDTLKIRTRSPFLGATAINLSPAVAEELQ
FT                   LDLPADGVVIADVDGGSIAHRVGLQKGDVIVAVNGVPVTTTRDLDRITRGALSAWEVTI
FT                   NRGGQQLTSVFSG"
     atgcgccttc cgacgcgcct tgccctggtc gccgcgctcg ccctcggccc cgccgccgcc        60
     gtggccgacc ctgctccccc gacgcgcgcc ctgccggaga gccgcgggca ggtgcagctc       120
     tccttcgcgc ccctcgtgcg cagggccgcg ccctccgtcg tcaacgtcta cggcgcgcat       180
     gtcgagaggc gctcggccaa ccgcaacgcg atggatgagt tcctgcgccg cttcttcggc       240
     gagaccgggc cgggcggcac ccaggagcgg gcgcagcgct ccctcggctc gggcgtgatc       300
     gtcgatgccg cgggcctcat cgtcaccaac aaccacgtca tcgagaacat gaacgaggtg       360
     aaggtggcgc tgagcgaccg gcgggaattc ccggcggaga ttgttttgcg cgacccccgc       420
     accgacctcg cggtgctgcg catcaaggcc ccgggcgggc tctccgccat ggaattcggg       480
     gattccgagg ggcttcaggt cggcgatttc gtgctcgcca tcggcaaccc gttcggcgtc       540
     ggccagacgg tgacgcaggg catcgtctcg gcgctcgcgc gcacgcaggt cggctcggcg       600
     gattaccagt tcttcatcca gaccgacgcg gccatcaacc cgggcaattc gggcggcgcc       660
     ctcgtcgacc tcaacgggca gctcgtcggc atcaacacgg cgatcttctc gcagtcgggc       720
     ggcagccacg gcatcggctt cgcgatcccg gccagcatgg tcaaggcggt ggtcgagacc       780
     gccaagggcg gcgggcgcct cgtgcgccgg ccctggctcg gcgcgcggct ccagaacgtc       840
     acgccggaca tcgccgacag cgtgggcctc gatcatccga ccggcgtgct ggtcgccagc       900
     atggttgcca agagcccggc cgaggaagcc ggcctcaagc gcggcgacgt gatcctgagc       960
     gtcgacgacc ggcccgtcga cgatcccgaa gccttcggct accgcttcgc cctcaagggg      1020
     atcagcggcg agacgaagct cgcggtgctg cgcggatcga accggatcac cgtgccggtc      1080
     cgcctcgccc ccgcgccgga gacgcggccg cgcgacacgc tcaagatccg cacgcgctcc      1140
     cccttcctcg gcgccacggc gatcaacctc tcgccggcgg tggccgagga gcttcagctc      1200
     gatctgccgg ccgatggcgt ggtgatcgcc gacgtcgatg gcggcagcat cgcccaccgc      1260
     gtcggcctcc agaagggcga cgtgatcgtc gcggtgaacg gggttccggt caccaccacc      1320
     agggatctcg accgcatcac ccgcggcgcc ctctcggcct gggaggtgac gatcaaccgc      1380
     ggcgggcagc agctcacctc ggtcttcagc ggctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page