(data stored in ACNUC7421 zone)

EMBL: CP001349.PE461

CP001349.PE461       Location/Qualifiers
FT   CDS_pept        complement(525456..526724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0471"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1719 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55513"
FT                   /db_xref="GOA:B8ICC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55513.1"
FT                   /translation="MHVAILTNFCLPRGGGEKVAIESARGLAEAGVAVSFLHGVDGPAD
FT                   PMLDHPGIRRIGLGLTDVWDEPAWRGARDGIWNRLAARRLRAALAELRPDCLHLHNWTR
FT                   SLSPAVLPVLAGCRLPVAVTLHDYFLVCPNGVYYRFDRAEPCSLAPLGARCLASPCDPQ
FT                   SRAHKLVRVARAAATRIGLMRGFGDRAIDLVHVSDASRARLEPMLPGSGFRHHRIDNPV
FT                   RVERRAPADPARGDAVVFVGRFTREKGADLVAEAARMAGLPALFIGDGPLAEKLAAMPG
FT                   VEVLGWREPAAVEALLRARARAVVAPSRWLETGPLTVYEALACGIPAIASNRAGAAARI
FT                   VPGETGFVTAPEAHLLARIFHDLADDALARRMGLAAHARYWAAPLTLAAHAEGAARLYA
FT                   TMIGRPAPLGATATAPSFQRSPV"
     atgcacgtcg ccatcctgac gaatttctgc ctgccgcgcg gcgggggcga gaaggtcgcg        60
     atcgaatccg ctcgtgggct cgccgaggcg ggcgtggcgg tgagcttcct gcatggcgtg       120
     gacgggcccg ccgacccgat gctcgatcac ccgggcatcc ggcgcatcgg cctcgggctg       180
     acggatgtgt gggacgagcc ggcctggcgc ggcgcgcgcg acggcatctg gaaccggctg       240
     gccgcaaggc gccttcgcgc ggcgctcgcg gagctgcgcc ccgactgcct ccatctccac       300
     aactggaccc gcagcctctc gcccgcggtg ctgccggtgc tggcgggatg ccgcctgccc       360
     gtcgctgtca cgctgcacga ctacttcctg gtctgcccga acggtgtcta ttaccgcttc       420
     gaccgggccg agccctgcag cctcgctccc ctcggcgccc gatgcctcgc ttctccctgc       480
     gatccgcaat cgcgcgccca caagctggtg cgcgtggcgc gcgcggccgc gacccggatt       540
     ggtctgatgc ggggttttgg cgatcgggcg atcgacctcg tgcatgtctc ggatgcgagc       600
     cgggcgcggc tggagccgat gctgccggga agcggttttc gccatcaccg gatcgacaat       660
     ccggtgcggg tggagcgccg tgcccccgcg gatccggcgc gcggcgatgc ggtcgtcttc       720
     gtcggccgct tcacccggga gaagggggcg gacctcgtcg cggaggcggc ccggatggcc       780
     ggcctgcctg ccctcttcat cggcgacggg ccgctcgccg aaaaactcgc tgcgatgccg       840
     ggcgtcgagg tgctgggctg gcgcgagccc gccgccgtgg aggcgctgct gcgggcccgg       900
     gcgcgggcgg tcgtcgcccc ctcccgctgg ctggagacgg gaccgctcac cgtctacgag       960
     gcgctcgcct gcggcattcc ggccatcgcc tcgaaccggg cgggggcggc cgcgcggatc      1020
     gtgccggggg agacgggctt cgtcaccgcg ccggaggccc atcttttggc ccgcatcttt      1080
     catgacctcg ccgacgacgc cctcgcgcgg cgcatggggc tggcggcgca tgcgcgctac      1140
     tgggccgcgc ccctgaccct cgcggcgcat gcggaaggcg cggcccggct ctacgccacc      1200
     atgatcggcc ggccggcgcc gctcggcgcg acggccacgg cgccatcttt tcagcgcagt      1260
     cctgtatag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page