(data stored in ACNUC7421 zone)

EMBL: CP001349.PE462

CP001349.PE462       Location/Qualifiers
FT   CDS_pept        526824..528098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0472"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1720 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55514"
FT                   /db_xref="GOA:B8ICC6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55514.1"
FT                   /translation="MDVVLILDHGHVNGGQAKVAIESALGLAARGHRVDLLAAVGPVDP
FT                   RLAAAGIGVTCLGQPDITTATSKLAFAGQMLWNGPAERALAGLLAGRDPRHTLVHMHAW
FT                   AKALSPSIFAAIRRAGLPALYTMHEFFLVCPNGGLYDYRRHEICHRRPLSGACMAANCD
FT                   MRSYPRKAMRLARHLLLERVARWPEGIRDVVTISALQEEVAGPLLPPGVRRHRIDNPIA
FT                   VEDAGPKPAGASGPITYVGRLSTEKGVVLLAEAARLAGIAPVFVGDGPEAETLRRLYPE
FT                   ARLLGWRDAAGVRDALRAASALVFPSIWYEGQPLTVYEALALGTPVVVSDACAGREAVA
FT                   DGETGYWFPSGDAAALAERLTRLRDPATVTALGAEAYRRYWAKPLTLSAHCDRLEEVYG
FT                   LVLRQGSAEPAAARAGDRPRLAPVG"
     atggacgtcg tcctcattct cgatcacggc cacgtcaatg gcggacaggc gaaggtcgcg        60
     atcgaatccg ccctcgggct tgcggcgcgt ggccaccggg tggatctgct cgccgcggtc       120
     gggccggtgg atccgcggct cgctgcggcc ggaatcggcg tcacctgcct cggccagccc       180
     gacatcacga ccgccacctc gaaactcgcc ttcgcgggcc agatgttgtg gaacgggccg       240
     gccgagcggg cgctcgcggg tctgctcgcc ggccgcgacc cgcgccacac cctcgtccac       300
     atgcatgcct gggcgaaggc gctctcgccg tcgatcttcg cggcgatccg gcgggccggg       360
     ctgcccgccc tctacacgat gcacgagttc ttcctcgtct gcccgaatgg cgggctctac       420
     gactaccgcc ggcacgaaat ctgccatcgc aggccgctct cgggcgcctg catggcggcg       480
     aattgcgaca tgcgcagcta tccccgcaag gcgatgcggc tcgcccgcca cctgctgctg       540
     gagcgtgtgg cgcgctggcc ggagggcatc cgggacgtcg tgacgatcag cgccctgcag       600
     gaggaggtgg ccggccccct gctgccgccg ggggtgcgcc gccaccgcat cgacaacccg       660
     attgcggtcg aggatgcggg gccgaaacca gcgggcgcga gcgggcccat cacctatgtg       720
     ggccgcctct ccaccgagaa gggcgtggta ctgctggcgg aggcggcgcg gcttgccggc       780
     atcgcgccgg tcttcgtcgg cgacgggccg gaggccgaga ccctgcgccg gctttatccc       840
     gaggcgcgac tcctcggctg gcgggatgcg gcgggcgtgc gggacgcctt gcgggccgcc       900
     tccgccctgg tcttcccgtc gatctggtac gagggccagc cgctgacggt ctatgaggcg       960
     ctggcgctcg gcacgccggt cgtcgtcagc gatgcctgcg cgggccgcga ggcggtagcg      1020
     gatggcgaga cgggctactg gtttccgtcg ggcgacgccg cggccctcgc cgaacgcctc      1080
     acccgcctcc gggacccggc caccgtcacg gccctcggcg ccgaagccta ccggcgctac      1140
     tgggcgaagc ccctgacgct gtcggcccat tgcgaccggc tggaggaggt ctacgggctc      1200
     gtcctgcggc aaggctcggc ggagcccgcg gcggcgcggg ccggagaccg gccccggctc      1260
     gcccccgtcg gctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page