(data stored in ACNUC7421 zone)

EMBL: CP001349.PE464

CP001349.PE464       Location/Qualifiers
FT   CDS_pept        529834..530706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0474"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1717 PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55516"
FT                   /db_xref="GOA:B8ICC8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC8"
FT                   /inference="protein motif:PFAM:PF00595"
FT                   /protein_id="ACL55516.1"
FT                   /translation="MPDPASPLLAFSQDLAGLVARTAPSIVAVHSHRHRASGFAWKSGL
FT                   IVTADEALAEEGAITVHTADGATVAATLAGRDPSTDIALLRIGRSDLPPAPLDPGPVAA
FT                   GSLAVAVGAEEGAPTVALGLVSRAGPAWRSLRGGEIDARIELDLALRRSGEGGLALDPA
FT                   GRAIGMVVFGPRRRALVIPAATIGRVAPHLESSGRIPLGYLGLGLQAVRREDGSTGLMV
FT                   MSVEPGGPGAQAGLRQGDMITAWNGQPIRGLGMLQAALGPGSPGSTVTLAISRGGAPLE
FT                   VALTIGERP"
     atgcccgatc ccgcctctcc ccttctggcc ttctcacagg acctcgccgg gctcgtcgcc        60
     cgcacagcgc cgagcatcgt cgcggtccac tcccaccggc accgcgcgag cggcttcgcc       120
     tggaagtccg gcctcatcgt caccgccgac gaggcgctgg ccgaggaggg cgcgatcacc       180
     gtgcacaccg ccgacggcgc aaccgtggcg gcgacgctcg cgggccgcga tccctcgacc       240
     gacatcgcgc tcctgcgcat cgggcgctcc gacctgccgc cggctcccct cgatcccggg       300
     ccggtggccg ccggcagcct cgccgtcgcg gtcggcgccg aggagggcgc gccgacggtc       360
     gcgctcggcc tcgtctcgcg cgcgggcccg gcctggcgca gcctgcgcgg tggcgagatc       420
     gacgcgcgga tcgaactcga tctggcgctg cgccgctccg gcgagggcgg tctcgccctc       480
     gacccggccg ggcgcgcgat cggcatggtg gtgttcggac cgcgccgccg ggccctcgtg       540
     atcccggccg ccacgatcgg ccgggtcgcg ccccatctcg aatccagcgg ccggattccc       600
     ctcggctatc tcggcctcgg cctccaggcg gtgcggcgcg aggacggcag cacgggcctg       660
     atggtgatga gcgtcgagcc cggcggcccc ggcgcgcagg ccggcctgcg ccagggtgac       720
     atgatcaccg cctggaacgg gcagccgatc cggggcctcg ggatgctcca ggcggccctc       780
     ggcccgggca gcccaggcag cacggtgacg ctcgctatca gccgcggcgg cgccccgctg       840
     gaggtggccc tgaccatcgg cgagaggccg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page