(data stored in ACNUC7421 zone)

EMBL: CP001349.PE466

CP001349.PE466       Location/Qualifiers
FT   CDS_pept        531185..532135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0476"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bra:BRADO2400 serine
FT                   protease DO-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55518"
FT                   /db_xref="GOA:B8ICD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55518.1"
FT                   /translation="MLHDASIPDDDLRDAPLDAYSRTVAGIVEAVGPAVVRVESPGRGL
FT                   GSGVVIAGDGLVLTNSHVVAGGRRVRLALADGAGAEATVIGDDPDTDLALLRADLPAGT
FT                   AAARLGESKRLRRGHLVVAIGNPLGFESTVTAGVVSALGRTLRARSGRLIDDVIQTDAA
FT                   LNPGNSGGPLVAASGEVVGIATAMIGGAQGLCFAVSSNTARFVVGEFVAHGRVRRAHLG
FT                   IVAQTLPLPRRIAVAVGAGPQAVRIGEVVPEGPAARGGLKAGDVILALDGAPVAGADDL
FT                   VRLLGAGRIGRPVAVTVLRDGAVRDHAVVPSERGP"
     atgctgcatg atgcctccat cccggacgac gatctgcgcg acgcgcccct cgacgcctat        60
     tcccgaaccg tcgccggcat cgtcgaggcg gtcggtccgg ccgtggtcag ggtcgagagc       120
     cctgggcgcg gcctcggctc gggcgtcgtc atcgcgggcg acgggctcgt gctcaccaac       180
     agccacgtgg tcgcgggcgg ccgccgggtc cgcctcgcgc tggcggacgg cgccggcgcg       240
     gaggcgaccg tcatcggcga cgatcccgac acagacctcg cgctgctgcg ggcggacctc       300
     cccgccggga cggcggccgc gcggctcggc gagtccaagc gcctgcgccg cggccacctc       360
     gtcgtagcca tcggcaaccc gctcggcttc gaatcgaccg tgacggcggg cgtcgtctcg       420
     gcgctcgggc ggaccctgcg cgcccgcagc ggccggctga tcgacgacgt catccagacc       480
     gatgccgcgc tcaatcccgg caattcgggc gggccgctcg tcgccgcgtc gggcgaggtc       540
     gtgggcatcg ccacggcgat gatcggcggc gcgcagggcc tgtgcttcgc ggtctccagc       600
     aacaccgcgc gattcgtcgt cggcgagttc gtcgcgcacg ggcgagtgcg gcgggcccat       660
     ctcggcatcg tcgcccagac cctgccgcta ccccggcgga tcgcggtcgc ggtcggcgct       720
     gggccgcagg cggtgcggat cggcgaggtg gtgcccgagg gccccgccgc ccgtggcggc       780
     ctcaaggccg gcgacgtgat cctcgccctc gacggcgccc cggtcgcggg cgccgacgac       840
     ctcgtgcgac tcctcggcgc ggggcggatc gggcgcccgg tcgccgtcac ggtgctgcgc       900
     gacggcgcgg tgcgcgatca cgccgtggtt ccgagcgagc gcggcccgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page