(data stored in ACNUC7421 zone)

EMBL: CP001349.PE467

CP001349.PE467       Location/Qualifiers
FT   CDS_pept        532201..533127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0477"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_1715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55519"
FT                   /db_xref="GOA:B8ICD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55519.1"
FT                   /translation="MSPIIAVANLSKVYASGFQALKSVSLEIRRGEIFALLGPNGAGKT
FT                   TLIGIICGIVSPTEGRVTVDGHDIRAEYRKARRLIGLVPQELTTDAFETVWATVSFSRG
FT                   LFGLRPDPAHIERVLKDLSLWEKRDSRIMTLSGGMKRRVLIAKALSHEPQVLFLDEPTA
FT                   GVDVALRQDMWRLVRRLRDQGVTVILTTHYIEEAEEMADRVGVIRRGEIILVEDKTELM
FT                   RKLGTKQLTLQLQTRLVAVPDTLSAHRLDLSEDGTELTYTYDSQGERTGITALLTDLRA
FT                   AGIRFRDLHTRQSSLEDIFVGLVKDPA"
     atgtcgccga tcatcgccgt cgccaacctg tcgaaggtct acgcctccgg gttccaggcg        60
     ctgaaatccg tctccctcga gatccgccgc ggcgagatct tcgccctgct cggcccgaac       120
     ggggcgggca agacgacgct catcggcatc atctgcggca tcgtcagccc gaccgaaggc       180
     cgcgtcacgg tggacgggca cgacatccgg gcggagtacc gcaaggcgcg ccgcctcatc       240
     ggccttgtgc cgcaggaact caccaccgat gccttcgaga ccgtctgggc gacggtgagc       300
     ttcagccgcg gcctgttcgg cctgaggccg gacccggccc atatcgagcg ggtgctgaag       360
     gatctctcgc tgtgggagaa gcgcgacagc cggatcatga ccctctcggg cggcatgaag       420
     cggcgggtgc tgatcgccaa ggcgctgtcg cacgagccgc aggtgctctt cctcgacgag       480
     ccgacggcgg gcgtcgacgt cgcgctccgc caggacatgt ggcgcctcgt gcggcggctg       540
     cgcgaccagg gcgtcaccgt gatcctcacc acccactaca tcgaggaggc cgaggagatg       600
     gccgaccggg tgggcgtgat tcgccgcggc gagatcatcc tggtcgagga caagaccgag       660
     ctgatgcgca agctcggcac caagcagctc accctccagc ttcagacccg cctcgtcgcg       720
     gtgccggaca cgctctcggc ccaccgcctc gacctctcgg aggacggcac cgaactcacc       780
     tacacctacg acagccaggg cgagcgcacc ggcatcacgg ccctgctcac ggacctgcgc       840
     gcggccggca tccgcttccg cgaccttcac acccggcaga gctcgctcga ggacatcttc       900
     gtcggcctcg tcaaggatcc cgcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page