(data stored in ACNUC7421 zone)

EMBL: CP001349.PE468

CP001349.PE468       Location/Qualifiers
FT   CDS_pept        533124..533885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0478"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: met:M446_1714
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55520"
FT                   /db_xref="GOA:B8ICD2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACL55520.1"
FT                   /translation="MNWPAIRAIYRFEMARTWRTLLQSIVAPVISTSLYFVVFGAAIGS
FT                   RLTVIEGVPYGAFIVPGLIMLSLLTQSIANASFGIYFPRFSGTIYEILSAPISPIEIVA
FT                   GYVGAAASKSILLGLIILATASLFVQIRIEHPVWMVLFLVLTAVTFSLFGFVIGLWADG
FT                   FEKLQLVPLLIVTPLTFLGGSFYSIDMLPPFWRGLSLVNPVVYLISGFRWSFYGHGDVS
FT                   VGVSLVMALAFLAICLALVTWMFRTGYRLKT"
     atgaactggc ccgcgatccg cgccatctat cgcttcgaga tggcgcgcac ctggcgcaca        60
     ctgctgcaga gcatcgtggc gcccgtgatc tcgacctcgc tctacttcgt ggtcttcggc       120
     gcggcgatcg gctcgcgcct gacggtcatc gagggggtgc cctacggcgc cttcatcgtg       180
     ccggggctga tcatgctctc gctcctcacg cagagcatcg cgaacgcctc cttcggcatc       240
     tacttcccgc gcttctccgg cacgatctac gagatcctct ccgccccgat ctcgcccatc       300
     gagatcgtcg ccggctatgt cggggcagcc gcctcgaagt cgatcctgct cgggctcatc       360
     atcctggcga cggcgtcgct cttcgtgcag atccgcatcg agcacccggt ctggatggtg       420
     ctgttcctgg tgctcaccgc ggtgaccttc agcctgttcg gcttcgtcat cggcctgtgg       480
     gcggacgggt tcgagaagct ccagctcgtg ccgctcctca tcgtcacgcc gctgaccttc       540
     ttgggcggga gcttctactc catcgacatg ctgccgccct tctggcgggg gctcagcctc       600
     gtcaacccgg tcgtctacct gatcagcggc ttccgctgga gcttctacgg gcatggcgat       660
     gtcagcgtgg gggtgagcct cgtgatggcg ctcgccttcc tggcgatctg cctcgccctc       720
     gtcacctgga tgttccggac cggctaccgg ctgaagacct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page