(data stored in ACNUC7421 zone)

EMBL: CP001349.PE469

CP001349.PE469       Location/Qualifiers
FT   CDS_pept        534002..534799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0479"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: met:M446_1711 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55521"
FT                   /db_xref="GOA:B8ICD3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL55521.1"
FT                   /translation="MADIPTPMMRKAPNRIPSTPRPGRAPSAATVICQELRTEIASLAR
FT                   LPGQPINEKEIAARYGVSRTPVHEAMLKLADEGLVEIFPQAGTYVARIPYRDLPEVIVI
FT                   RRALEESSARLAAEHAKPADLAALDRIMVALDEAAADQDREAFRQRDEDFHAAVAGAAG
FT                   YPGLWRLTRQVKIQVDRFRRLTLPQPGRFARILIEHRAVLDAIRARDPAAACAAMGAHL
FT                   DGLLAELGGIAWLNAEYFDMSGIDPPVLTETDKRDEGVSGLGL"
     atggcggaca tccccacgcc gatgatgcgc aaggcgccga accgcatccc gtccacgccg        60
     cggccgggcc gggcgccgtc cgccgcgacg gtgatctgcc aggagctgcg gaccgagatc       120
     gcctccctcg cccgactgcc cggccagccg atcaacgaga aggagatcgc cgcccgctac       180
     ggcgtgagcc gcacgccggt ccacgaggcg atgctgaagc tcgccgacga ggggctggtc       240
     gagatcttcc cccaagccgg aacctacgtc gcccgcattc cctatcgcga cctgccggag       300
     gtcatcgtga tccgccgggc gctcgaggaa tcgagcgccc ggcttgcggc cgagcacgcg       360
     aagcctgccg atctcgccgc tctcgaccgc atcatggtcg ccctggacga ggccgcggcg       420
     gatcaagacc gtgaggcctt ccggcagcgg gacgaggatt tccatgccgc ggtcgcgggg       480
     gcggccggct atccgggcct gtggcggctg acccggcagg tgaagatcca ggtcgaccgc       540
     ttccggcgcc tcaccctgcc gcagccggga cggttcgcgc gcatcctcat cgagcaccgg       600
     gcggtgctcg acgccatccg ggcacgcgac cccgccgcgg cctgcgccgc catgggcgcg       660
     catctcgacg gcctgctcgc ggagctcggc ggcatcgcct ggctcaacgc ggaatatttc       720
     gacatgtccg ggatcgatcc ccctgttttg accgagaccg acaaacggga tgagggggtg       780
     tcgggcttgg gcctgtag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page