(data stored in ACNUC7421 zone)

EMBL: CP001349.PE47

CP001349.PE47        Location/Qualifiers
FT   CDS_pept        complement(52794..54176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0048"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: met:M446_0048
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55099"
FT                   /db_xref="GOA:B8IU54"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU54"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACL55099.1"
FT                   /translation="MDDRTRRLLRGPIGPTLLRLAVPNVLVMLVQAGVGLIETAFVAGL
FT                   GTDALAGMALVFPLVMTVQMISAGAVGGGVLSAVARALGAGRREAAEAVAWHAVAIGLA
FT                   LGLLTTALALAFGPALYRTMGAEGATLAAACAYGGVVFAGAVLIWLFNALAAVIRGTGN
FT                   MALPAAVTCTGAAVLVPLSPALIFGVGPLPGLGIAGGGVAVLAYYAVGTAVLARYLRAG
FT                   RGVLRLGRPPALAWAPAREILRVGAASSLVSLTTNVTIATATGLVARFGSSAVAGYGTG
FT                   ARLEYLLVPLVFGLGAPISAMVGTSIGAGDRARALRVAWTGAALAVGLTETIGLAAALW
FT                   PDLFLRVFATDPAMLGTGARYLREVGPFYGFVGLGLSLYFAAQGAGRIGWPLAAGLTRL
FT                   TLAVGGGWFALRTGAGLDGIFLAQALGLVALGSINAGSVAAGVWFRARPLPAASLAARS
FT                   GA"
     atggacgacc gcacgcgccg cctgctccgg ggaccgatcg gcccgacgct cctgcgtctc        60
     gccgtcccca acgtgctcgt catgctggtc caggccggcg tcggcctgat cgagaccgcc       120
     ttcgtcgccg gcctcggcac ggatgcgctc gccgggatgg cgctcgtctt cccgctcgtc       180
     atgacggtgc agatgatctc ggccggggcc gtcggcggcg gcgtcctctc ggcggtggcg       240
     cgggccctcg gtgccggccg gcgcgaggcg gcggaggcag tggcctggca cgccgtcgcg       300
     atcggcctcg cgctcgggct cctcaccacg gcgctggcgc tcgccttcgg tccggcgctc       360
     taccgcacga tgggggcgga gggcgcgacg ctcgcagcgg cctgcgccta tggcggcgtg       420
     gtcttcgccg gtgcggtcct gatctggctg ttcaacgccc tcgctgcggt catccggggc       480
     accggcaaca tggcgcttcc ggccgccgtc acctgcaccg gcgccgccgt gctggtgccc       540
     ctgtcccccg ccctgatctt cggtgtcggt ccgctgccgg ggctcggtat cgccggggga       600
     ggggtggcgg tgctcgccta ttacgcggtc ggcacggccg tgctggcgcg ctacctgcgc       660
     gcggggcgcg gcgtgctgcg gctcggccgc ccgccggcgc tggcctgggc gccggcccgg       720
     gagatcctgc gcgtcggggc ggcctcgtcg ctggtcagcc tgaccacgaa cgtcaccatc       780
     gcgaccgcga cgggtctcgt cgcccgcttc ggctcctcgg cggtggccgg ctacggcacc       840
     ggggcacggc tcgaatacct gctggtgccc ctcgtcttcg gtctcggggc gccgatctcc       900
     gccatggtcg gcaccagcat cggggccggg gaccgggcgc gggccttgcg cgtggcctgg       960
     accggggccg ccctcgcggt cggcctgacc gagacgatcg ggctcgcggc ggctctgtgg      1020
     ccggacctgt tcctgcgggt cttcgcgacc gatccggcca tgctgggcac gggtgcccgc      1080
     tacctgcgcg aggtcggccc cttctacggc ttcgtggggc tcggcctgtc cctctacttc      1140
     gccgcgcagg gggcaggccg catcggctgg ccgctcgcgg ccggcctcac ccggctgacc      1200
     ctcgcggtcg gcggcgggtg gttcgccctg cggacggggg cgggcctcga tggcatcttc      1260
     ctggcccagg ccctcggtct cgtggcgctc ggatcgatca atgccgggtc ggttgctgcg      1320
     ggcgtctggt tccgggcccg tccacttccg gccgcctccc tcgcggcccg ctcgggagca      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page