(data stored in ACNUC7421 zone)

EMBL: CP001349.PE470

CP001349.PE470       Location/Qualifiers
FT   CDS_pept        535856..536548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55522"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2269"
FT                   /protein_id="ACL55522.1"
FT                   /translation="MLKEFGHAIWTANGSDVVAMLGFHYPTRMVVISLSGENLFVWSPV
FT                   ALTEDLRADVDALGKVRYLVAPNSLHHLFIADWKHAYPDARIYAAPGLQEKRKDIAFDD
FT                   ELDGASVPEWSGEIEYVVVRGNAITSEAVFFHRKSGTVIFTDLIQQFPAGWFSGWRSIV
FT                   AKWDLMLGPEPSVPRKFRAAFTNRHAARGSLERILAWPSEKVLMAHGTPVIEDSQAFLR
FT                   RAFRWLVA"
     atgttgaaag aatttggtca cgcgatatgg acggccaatg gttctgatgt cgtggccatg        60
     cttggatttc actacccgac gcgcatggtt gtcataagtc tgtctggcga aaaccttttc       120
     gtatggtcgc cagttgcatt gacggaggac cttcgcgccg atgtcgatgc tctcggaaag       180
     gtccgctatc tggtggcgcc caactcgctg catcacctgt tcatcgctga ttggaagcat       240
     gcttatccag atgcacggat ctatgccgct cctggactgc aagagaagcg caaagacata       300
     gcatttgacg acgagctgga cggcgcgtca gttccggagt ggtccggaga gatcgaatac       360
     gttgtagtgc gaggcaacgc gataaccagt gaggcggtgt tttttcaccg caagagcggc       420
     accgtgatct tcaccgatct gatccagcaa tttcccgccg gctggttttc gggctggcgc       480
     tcgatcgttg cgaaatggga ccttatgctt ggcccggaac catcggtgcc tcgaaagttc       540
     cgcgcagcct tcaccaatcg ccatgcggcc cgcggatcgc tcgaacgcat tctcgcatgg       600
     ccctctgaaa aggtgttgat ggcgcatgga acgcctgtca tcgaagacag ccaagcattc       660
     ctgcggcgtg cattcagatg gttggtagcc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page