(data stored in ACNUC7421 zone)

EMBL: CP001349.PE471

CP001349.PE471       Location/Qualifiers
FT   CDS_pept        536733..537719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0481"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_1704 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55523"
FT                   /db_xref="GOA:B8ICD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55523.1"
FT                   /translation="MTDLRHAVVVITGASSGIGRAATLAFARRGARVALAARRREALED
FT                   LARECRAQGGKAIPVPTDVTDPDAVEHLARTAHEAFGGLDVWINNAGTGVFGPFQDAPL
FT                   DLHRRTIEVNLLGGVYGAYAALPYFLRQGHGTLITTISLGGWAPTPFAAAYTASKFGLR
FT                   GFTASLRQELRRHRHIHVCSVFPTIVDTPGLEHGANVSGRAIDTGPLVYAPEDVAETFV
FT                   YLVRHPHDEVAVGWPARLAQAAYALAPWPTEHLMGIAIHRALDRARPAPITHGAIRAPV
FT                   PERPRTSGGWRARKGLPSARTLSTVGAVMGAAGLMLLASTRAAARAR"
     atgaccgacc tgcgccatgc cgtggttgtg atcaccggcg catcgagcgg catcggccgc        60
     gcggccaccc tggccttcgc gcgtcggggc gcccgggtgg cgctcgccgc ccggcgccgc       120
     gaggccctgg aagatctggc gcgggagtgc cgcgcgcagg gcgggaaggc gatccccgtg       180
     ccgacggacg tcaccgaccc cgacgcggtc gagcacctcg cccgcaccgc gcacgaggcc       240
     ttcgggggcc tcgacgtctg gatcaacaac gccggcaccg gcgtgttcgg cccgttccag       300
     gacgcgcccc tcgacctcca ccgccgcacc atcgaggtca acctgctcgg cggcgtctac       360
     ggcgcctacg ccgccctgcc ctatttcctg cgccagggcc acgggacgct gatcaccacc       420
     atctcgctcg gcggctgggc acccaccccc ttcgcggcgg cctacacggc gagcaagttc       480
     ggcctgcgcg gcttcaccgc gagcctgcgc caggagttgc gccgccaccg gcacatccac       540
     gtctgctcgg tcttccccac gatcgtggac acgcccgggc tggagcacgg ggcgaacgtc       600
     tccgggcgcg ccatcgacac cgggccgctc gtctacgcgc ccgaagacgt ggccgagacc       660
     ttcgtgtatc tcgtgcgcca tccccacgat gaggtcgcgg tgggctggcc cgcccgcctc       720
     gcccaggccg cctatgcgct cgccccctgg ccgaccgagc acctgatggg catcgccatc       780
     catcgggccc tcgaccgggc tcggccggcg ccgatcacgc acggggcgat ccgcgcaccg       840
     gttcccgaac ggccgcggac gagcggcggc tggcgggccc gcaagggcct gccctcggcg       900
     cgcacgctga gcacggtcgg cgcggtcatg ggcgccgccg gcctgatgct gctcgcctcg       960
     acccgggcgg cggcgcgggc gcgttga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page