(data stored in ACNUC7421 zone)

EMBL: CP001349.PE472

CP001349.PE472       Location/Qualifiers
FT   CDS_pept        complement(537737..538459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0482"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: met:M446_1703
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55524"
FT                   /db_xref="GOA:B8ICD6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACL55524.1"
FT                   /translation="MADRTGSLKVAAIGDLHVKEEGQTSYRDLFGEISREADVLVLAGD
FT                   LTDLGTAREAEILAEELRACAIPVVGVLGNHDYESGTPEEVCRILRQTGMRLLEGQSVE
FT                   IEGVGFVGVKGFVGGFGRFTLGAFGEAAIKALVAESQHEAMRLENAMRHVASRRALVVL
FT                   HYAPVAATVQGEPPEIFPFLGSSRLAETIDRFEVGAVVHGHAHRGTFEGRTPGGVPVYN
FT                   VAIQIPKPNGRPYALLEL"
     atggctgacc gcaccggatc gctcaaggtc gccgccatcg gtgatcttca cgtcaaggaa        60
     gaggggcaga cctcgtaccg ggacctgttc ggcgagatct cgcgggaggc cgacgtgctg       120
     gttctcgcgg gcgacctgac cgatctcggc acggcgcggg aagcggagat cctcgccgag       180
     gagctgcgcg cctgcgcgat cccggtggtc ggggtgctcg gcaatcacga ttacgaatcg       240
     gggacgcccg aggaggtctg ccgcatcctg cgccagaccg ggatgcggct cctggaggga       300
     cagtcggtcg agatcgaggg tgtgggattc gtcggcgtga agggcttcgt gggcggcttc       360
     gggcgcttca cgctcggcgc cttcggcgag gccgccatca aggccctggt ggccgagagc       420
     cagcacgagg cgatgcggct cgagaatgcc atgcggcatg tggcgagccg ccgggccctc       480
     gtggtgctgc actacgcacc ggtcgccgcg acggtgcagg gcgagccgcc cgagatcttc       540
     cccttcctcg gctcctcccg cctcgccgag acgatcgacc ggttcgaggt cggcgccgtg       600
     gtgcacggcc acgcgcaccg gggcaccttc gaaggccgca cgcccggcgg tgtcccggtc       660
     tacaacgtgg cgatccagat cccgaagccg aacggccgac cctacgcgct gctggagctc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page