(data stored in ACNUC7421 zone)

EMBL: CP001349.PE473

CP001349.PE473       Location/Qualifiers
FT   CDS_pept        complement(538452..539270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD7"
FT                   /inference="similar to AA sequence:KEGG:M446_1702"
FT                   /protein_id="ACL55525.1"
FT                   /translation="MPDPRSPLPQVIAKAEPTLVSPEAEAFYAEAISRLVASGLPFLLA
FT                   GTYAVSAYTGITRETKDLDVFCKAGDAPRILAHFQDLGYTVAIEDERWLGKVFGDGHFF
FT                   DVIYASPSGATPVTEAWFAHAHQIELFGHTVRIIGPTELVWSKAFIQMRNRFDGADVAH
FT                   TILRAHEAIDWTRLLAYMEQHWELLLMHLLAFRWIYPTDREVVPAWLLDELLDRLAQLR
FT                   KLPPPQMKICRGRMLSRVDYAIDVKEWGYADLGGEGAWRDDITENAQDHG"
     atgccggatc cccgctctcc cctgccgcag gtcatcgcga aggcggagcc aacgctcgtc        60
     agcccggagg ccgaggcctt ctatgccgag gcgatctccc ggctcgtcgc ctcgggcctg       120
     cccttccttc ttgccggcac ctacgcggtc agcgcctata cggggatcac ccgcgagacg       180
     aaggatctcg acgtcttctg caaggccggg gatgcgccgc gcatcctcgc ccatttccag       240
     gacctcggct acacggtcgc catcgaggac gagcgttggc ttggcaaggt cttcggcgac       300
     gggcatttct tcgatgtgat ctacgcctcg ccgagcggcg cgaccccggt caccgaggcg       360
     tggttcgccc atgcccacca gatcgaattg ttcggccata ccgtgcggat catcgggccg       420
     accgaactcg tctggtcgaa ggccttcatc cagatgcgca accgcttcga cggcgccgac       480
     gtggcgcaca cgatcctgcg ggcacacgag gcaatcgatt ggacgcggct cctcgcctac       540
     atggagcagc actgggaatt gctgctcatg catctcctcg ccttccgctg gatctacccg       600
     accgaccgcg aggtggtgcc ggcttggctc ctcgacgagc tgctcgaccg gctcgcccag       660
     ctgcgcaagc tgccgccgcc gcagatgaag atctgccgcg gacgcatgct gtcgcgggtc       720
     gattacgcga tcgacgtcaa ggaatggggc tacgcggatc tcggtggcga gggcgcgtgg       780
     cgggacgaca tcacggagaa tgctcaggac catggctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page