(data stored in ACNUC7421 zone)

EMBL: CP001349.PE474

CP001349.PE474       Location/Qualifiers
FT   CDS_pept        complement(539597..547603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0484"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: Hemolysin-type calcium-binding region;
FT                   glycerophosphoryl diester phosphodiesterase;
FT                   metallophosphoesterase; KEGG: atc:AGR_L_909 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55526"
FT                   /db_xref="GOA:B8ICD8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD8"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACL55526.1"
FT                   /translation="MSTTTPANAVEASTDWMLGIVKAAPNQTLRVAPGGTGTASAYTLV
FT                   YDVYVPAANAGGWLPFLQTDSANSNDGDLFGKIEAGSYGIGIGGDYKGSAKLDAWNRIA
FT                   FTVETQNGEVAIGKYINGELVGSQTSTSTDRYAIDRSKGFLIFSDEDGETSAGYLGSFL
FT                   FADRALSTDEVKALGGASKEGVSKAAIAGASQFDFTDGTLNATFGTATLQATGLTPTFG
FT                   TPATLGIPAMPDASEVLTPGRANDFLVIAHRGAQAYRPEHTLEAYKLAIDMGADFIEPD
FT                   LVSTKDGVLVARHDPWLASVKLDAAGTIARDANGKPIVTSQTTNVADIAKFADKLTVKD
FT                   YAGGKVAGWFVSDFTLAEIKELRAREDQPQLRPGSASYDNQFQIPTLAEIIALVKQTEA
FT                   DTGLTIGIYPETKDPTFHKIQGLDTSKMLIDALKEAGFIDPSRVFIQSFEFANLIELKT
FT                   KIMPAAGVNLPLVQLVYFQAPYVPDDVAYNFSGAPGADPSVYNVLGLNLSATSTYEAFT
FT                   TPQALKTIANLYASGLGPDMPFVIDAATGAPKQLLLDVHAAGLKVHPYTHRDDAFGANS
FT                   KSFIDALTKAGVDGVFTDNTDTVVNAVLAAQPVQDAAGTFTGVPSLGGDPGVLHVPAPA
FT                   KKTDGFVFDPAIDGTATTYTMIFDVLVKTGDFAGDWNALFQTNLTNGDDAKFFMKKDGA
FT                   TFGIGKGDYHGSATLDTWHRIAVTLTANGDGTSTMRKYIDGVEVGSSAYATADYTIDDK
FT                   GVLLFADNDGEGVPSHLNSFYFTDRAMTGDEIKALGGSKVGGVLAAAPAQGRATQFDFA
FT                   NGTLAASFGSGTMAAAATVVPPEPAADKQAVVFGTPESLGLPALPGGQDGVISAPSFDP
FT                   DHGLELKPGFAPKNGSATFDTYTIVYDLYLPKQTGLGSIFQSDLSSRSDGDLWLGFRDD
FT                   QAVLGTDSQDEGRITLDAWHRLAFSIERISSDSFTLKKYVDGVKIGQQTVKNDFVIGDK
FT                   GFLLFADDSNETPKFSLSSVAFMEKTLSESEVAALGGASAGGPFTAPIAGVNGVQFDFS
FT                   KGEFSPSFGSGTLTARAPGVVEPPPPASVRVGAPIKDMLVTPTAANTVIDLAGVFAGNN
FT                   LTYKVETAEGRVVNASVADGKLTLDFGGLGHSDVRVTATDAAGNTAADAFRVRVAGPNA
FT                   YTIAVLPDTQDYTDQNTANGPPETFYRMTEWLAAHKDARKIQFVAHVGDVTQNNLPTEW
FT                   VVAEKAMRTLDGKIPYSLLPGNHDQANGGTAANHSSVNLDTLFSPEKQAATNPNTFRGV
FT                   YDQEPTSSRNNYHTFTAPDGTKWLILSMEFGPRDDVIRWASEVLDKHLDHRVMIISHSL
FT                   TDFASRHDAAGLGLYDEGTGADYGLRNDPQSVNDGETVYRLLSAKYPNISFTFSGHIFG
FT                   DGAETNVSYSQHGNPVYEMLVNYQNGISREITGNGNEALGNRGGNGAIRLVTIDPDNRT
FT                   LSTETYFTEFDDYLDGYRVKPELDRNGLTGSYRGHQEEFGNVELGAPELRAVAKAGDDL
FT                   YLSAPAGADRLAVTLNASRTLDPAHDIASYVWRNADGDVIARGAKPTVDLAVGRHPLTL
FT                   EVTDAKGHVTTDQKLVVVKGDATLLVENFNDGNAYGWVKPPVPVKTLSTGTPAEFGLPA
FT                   LPGGEKKVAFVPALPSNEGLRVTPNLGAPAGTRIASYSVIFDILVPPGQGDWTSLMQTD
FT                   VANKSDGDLFIRSNGNGTGGIGISSNYTGSLQYGAWQRVAFTFKEEADGTVTLNKFIEG
FT                   VKVGSQSVSGDRFKLDVSQGALFFSDEDGEVSKLYVSSLLITDKVYTEAEIAALGGAKA
FT                   GGIVASAPTPLSVQFDFNDAGLRPSFGPAEMSFGSLDNTGSSGNFVVKGSVFARPTAAE
FT                   GQAAPEARLYDQSDAKGNLLLWGDATAKSWSDYAFEATLQSTDNDAIGLVFSYQDAQNH
FT                   YRLTFNGKTNRRELVKVKDGVETVLASAAKGQPFQTDMAVKVAVLDGKISAFLNGSSIF
FT                   DGVVKDATDPLKGGTVGLYSSEQRSSMFDDLVVTKVKALAHAGADQRAIDFDGDGLASV
FT                   RLDAGASLGLADIVSYRWTDANGDEVATGIEPEVKLGLGSNALTLTVTDANGATATDRV
FT                   DIDVMAKSQVLLNESFGSAEALAKWRILDEGESGGVGPDGKSSQWELRDGRLVQLSDLQ
FT                   SRQLEWQGGATAPNLWTRGWSPLGDGVNVLRRGTQAIYDDPAAKEWTDYSVEATIKTLD
FT                   NDALGFLIHYVDAKNYYKVELDAEGNYDRKAGNGAGSLFQITRVRDGVEEVLYQVPAKY
FT                   EPGTEMRLRVDVIGGKISAFLDGEAIFAYPIEDHAHPKGTVALYSWGSEGVSFDDVRVI
FT                   APGEAAPGNLQLSGGEGDDSLTGSAGNDTIRGGAGNDTLKGFAGADQLFGQNGNDTVWG
FT                   GAGNDFVSGGFGADSVSGDAGDDLVFSDDDDDVADGGAGNDRVYGGTGADLVFGAAGDD
FT                   QVYGEWGNDFVSGGEGHDFVSGGFGNDEVNGDAGNDLLFGDDGDDAVSGGEGDDRVYGG
FT                   TGNDLVSGEAGADQVFGEQGEDVLLGGAGSDYLSGGAGADQLFGGEGADLLFGNAGADA
FT                   LTGGLGSDAFAFGRGDGQDVIRDFVTGGAERDVIAFNNGAFGSFAAVQAALRQEGSDAV
FT                   IAYGTGDTITLQNVQATSLTAQNFTFA"
     atgtccacga ccaccccggc gaatgcagtc gaagcatcga ccgactggat gctcggcatc        60
     gtcaaggctg cgccgaacca gaccctgcgg gtcgctcccg gcggcacggg cacggcgagc       120
     gcctatacgc tggtctacga cgtctatgtt cccgcggcga atgcgggcgg ctggctgccc       180
     ttcctgcaga cggactcggc caacagcaac gacggcgacc tcttcggcaa gatcgaggcc       240
     ggcagctacg gcatcggcat cggcggcgac tacaagggtt cggccaagct cgatgcctgg       300
     aaccgcatcg ccttcacggt cgagacccag aatggcgagg tggcgatcgg caagtacatc       360
     aacggcgagt tggtcggcag ccagacctcg accagcaccg atcgctacgc catcgacagg       420
     agcaagggct tcctgatctt ctccgacgag gacggcgaga cctccgcggg ctacctcggc       480
     agcttcctgt ttgccgaccg ggcgctgagc accgatgagg tcaaggcgct cggcggagcg       540
     tcgaaggagg gcgtgtcgaa ggcggccatt gcgggcgcca gccagttcga tttcaccgac       600
     ggcacgctca acgccacctt cggcacggcg accctgcagg cgaccgggct cacaccgaca       660
     ttcggcaccc cggcaacgct cggcattccg gccatgccgg acgcgagcga ggtgctgacg       720
     cccggccggg ccaacgactt cctggtgatc gcccatcgcg gcgcgcaggc ctaccgcccc       780
     gaacatacgc tcgaagccta caagctcgcg atcgacatgg gcgcggattt catcgagccc       840
     gatctggtct cgaccaagga tggcgtgctg gtcgcccgcc acgatccctg gctcgcctcc       900
     gtgaagctcg atgcggccgg cactatcgcg cgtgacgcga atggcaagcc gatcgtcacg       960
     agccagacga ccaatgtcgc cgacatcgcg aaattcgccg acaagctgac ggtcaaggac      1020
     tatgccggcg gcaaggtcgc gggctggttc gtcagcgact tcacgctcgc cgagatcaag      1080
     gaactgcgcg cgcgcgagga ccagccccag ctccgcccgg gctcggcgag ctatgacaat      1140
     cagttccaga tcccgacgct ggccgagatc atcgccctcg tgaagcagac cgaggccgat      1200
     acggggctga cgatcggcat ctatcccgag accaaggacc cgacgttcca caagattcaa      1260
     ggtctcgata ccagcaagat gctgatcgac gcattgaagg aggcaggttt tatcgatccg      1320
     agccgtgttt tcatccagtc cttcgaattc gccaatctga tcgagctcaa gacgaaaatc      1380
     atgccggccg ccggcgtgaa tctcccgctc gtgcaattgg tttatttcca agccccctat      1440
     gttcctgacg atgtcgccta caatttctcc ggcgcgcccg gtgccgatcc ttcggtctat      1500
     aatgtgctgg gtctcaacct ctcggcgacg tccacctatg aggctttcac gaccccgcaa      1560
     gctctgaaga cgatcgccaa cctctatgca tcgggcctcg gccccgacat gcccttcgtc      1620
     atcgacgctg caaccggtgc gcccaagcag cttctcctcg atgtccatgc ggccggtctg      1680
     aaggtgcatc cctacacgca ccgcgacgat gccttcggcg ccaattcgaa gagcttcatc      1740
     gacgccctga cgaaggccgg cgtggacggc gtcttcacgg acaatacgga tacggtggtc      1800
     aacgcggtcc tcgccgcgca gccggttcag gacgcggccg gcaccttcac gggcgtgccc      1860
     tcgcttggcg gcgatcccgg cgtgctccat gtcccggccc cggcgaagaa gaccgacggc      1920
     ttcgtgttcg atccggccat cgacggcacg gccacgacct acaccatgat cttcgacgtg      1980
     ctggtcaaga cgggtgattt cgcgggcgac tggaacgcgc tgttccagac caacctgacc      2040
     aatggcgacg acgccaagtt cttcatgaag aaggacggtg cgaccttcgg catcggcaag      2100
     ggcgattatc acggcagcgc caccctcgac acatggcacc gcatcgccgt gacgctgacc      2160
     gccaatggcg acggcacctc gaccatgcgc aaatacatcg acggggtcga ggtcggcagc      2220
     tcagcctatg cgacggcgga ttacaccatc gacgacaagg gcgtgctcct gtttgccgat      2280
     aacgacggcg agggcgtgcc ctcgcacctc aacagcttct acttcaccga ccgggcgatg      2340
     accggcgacg agatcaaggc gctcggcggg tcgaaggtcg gcggcgtgct cgcggccgcg      2400
     cccgcgcagg gccgtgccac ccagttcgac ttcgccaacg gaaccctggc ggccagtttc      2460
     ggcagcggga cgatggcggc agccgccacc gtggtgccgc cggagccggc cgccgacaag      2520
     caggccgtcg tcttcggcac gccggaatcg ctcggcctgc cggcgcttcc cggcgggcag      2580
     gacggcgtca tcagcgcgcc gagcttcgat cccgaccacg ggctcgaatt gaagccgggc      2640
     ttcgccccga agaacggcag cgccaccttc gacacctaca caatcgtcta tgatctctat      2700
     ctgccgaagc agaccggcct cggctcgatc ttccagagcg atctcagcag ccgcagcgac      2760
     ggcgatctct ggctcggctt cagggacgac caagccgtcc tcggcaccga cagccaggat      2820
     gagggcagga tcaccctcga tgcctggcat cgcctggcct tctctatcga gcggatcagc      2880
     agcgactcct tcaccctgaa gaaatatgtc gatggcgtaa aaatcggcca gcagaccgtc      2940
     aagaacgact tcgtcatcgg cgacaagggc ttcctgctgt ttgccgatga cagcaacgaa      3000
     acgccgaaat tctcactgtc ctccgtcgcc ttcatggaga agaccctgag cgagagcgag      3060
     gtcgcggctc tcggcggcgc gagtgccggc ggtccgttca ccgcgcccat cgccggggtg      3120
     aacggcgtcc agttcgactt cagcaagggc gaattcagcc cgagcttcgg cagcggcacc      3180
     ctgaccgcgc gcgcgcccgg cgtggtggag ccgccgccgc ccgccagcgt gcgggtgggc      3240
     gcccccatca aggacatgct ggtcacgccc acggccgcga acacggtcat cgacctcgcc      3300
     ggcgtcttcg ccggcaacaa tctcacctac aaggtcgaga ccgccgaagg ccgggtggtc      3360
     aacgcttcgg tcgcggacgg caagctgacg ctcgacttcg gcggcctcgg ccattcggat      3420
     gtgcgggtga cggcgacgga tgccgccggc aataccgccg ccgatgcctt ccgcgttcgt      3480
     gtcgccggtc cgaacgccta tacgatcgcg gtgctgcccg acacgcagga ctataccgac      3540
     cagaacaccg ccaacggccc gcccgaaacc ttctaccgca tgacggaatg gctggccgcc      3600
     cataaggatg cgcgcaagat ccagttcgtc gcgcatgtcg gtgacgtcac gcagaacaat      3660
     ctgccgaccg aatgggtcgt cgccgaaaag gccatgcgca cgctcgacgg caagatcccc      3720
     tattcgctgc tgccgggtaa tcacgaccag gcgaatggcg gcacggcggc caatcactca      3780
     tcggtcaatc tcgacacgct gttctcgccg gagaagcagg cggcgaccaa ccccaatacc      3840
     ttccgcggtg tctacgacca ggagccgacc tccagccgca acaattacca caccttcacc      3900
     gcgccggacg gcaccaagtg gctgatcctg tcgatggagt tcggcccgcg cgatgacgtg      3960
     atccgctggg cgagcgaggt gctcgacaag catctcgacc accgggtcat gatcatctcg      4020
     cattcgctga ccgacttcgc cagccgccac gacgccgccg gcctcggcct ctatgatgaa      4080
     ggcaccggcg ccgattacgg actgcgcaac gatccgcaga gcgtcaatga cggcgagacc      4140
     gtctatcgcc tgctctcggc caaatatccg aacatcagct tcaccttctc cggccatatc      4200
     ttcggcgacg gggcggagac caatgtcagc tactcgcagc acggcaatcc cgtgtacgag      4260
     atgctggtca attatcagaa cggcatttcc cgtgagatca ccggcaacgg caacgaagcc      4320
     ctcggcaatc gcggcggcaa cggcgccatc cggctggtga cgatcgatcc cgacaacagg      4380
     acgctctcga cggaaaccta cttcaccgaa ttcgacgatt atctcgacgg ctatcgcgtc      4440
     aagcccgagc tcgaccgcaa cgggctgacg ggctcctacc gcggtcacca ggaggagttc      4500
     ggcaacgtcg agctcggggc gccggagctg cgcgccgtcg ccaaggccgg ggatgacctc      4560
     tacctgtccg ccccggccgg cgcggacagg ctggcggtga cgctcaacgc ctcgcgcacg      4620
     ctcgatccgg cgcacgacat cgcttcctat gtctggcgca atgccgatgg cgatgtcatc      4680
     gccaggggcg ccaagccgac ggtcgatctc gccgtcggcc ggcatccgct gacgctcgaa      4740
     gtgacggacg ccaagggtca cgtcacgacc gatcagaagc tggtggtcgt caagggcgat      4800
     gccacgctgc tggtcgagaa cttcaacgac ggcaatgcct acggctgggt gaagcccccc      4860
     gtccccgtca agacgctctc caccggcacg ccggccgagt tcggcctgcc ggcgctcccg      4920
     ggcggcgaga agaaggtggc gttcgtcccg gcgctgccct cgaacgaagg gctgcgcgtc      4980
     acgcccaatc tcggcgcgcc cgcgggcacg cgcatcgcct cctattcggt catcttcgac      5040
     atcctcgtcc cgcccggcca gggtgactgg acgagcctga tgcagaccga cgtcgccaac      5100
     aagagcgacg gcgatctgtt catccgcagc aatggcaacg gcaccggcgg catcggcatc      5160
     agcagcaatt atactggcag cctgcaatac ggcgcctggc agcgcgtcgc cttcaccttc      5220
     aaggaggagg ccgacgggac ggtcaccctg aacaagttca tcgagggcgt gaaggtcggc      5280
     tcgcagagcg tgtccggcga ccgcttcaag ctcgacgtga gccagggggc gctgttcttc      5340
     tcggacgagg acggcgaagt ctcgaagctc tatgtctcga gcctgctcat caccgacaag      5400
     gtctacacgg aggccgagat cgcggccctc ggcggagcca aggccggcgg catcgtggcg      5460
     tcagcgccga cgccgctctc cgtgcagttc gacttcaacg atgccggcct caggccgagt      5520
     ttcggcccgg ccgagatgag cttcggctcg ctggacaata ctggcagcag cggcaatttc      5580
     gtggtcaagg gctcggtctt cgcgcgcccg acggctgcag aggggcaggc cgcgccggag      5640
     gccaggctct acgaccagtc cgacgccaag ggcaatctgc tgctctgggg cgacgccacg      5700
     gccaagtcct ggtccgacta tgccttcgag gcgacgctgc aatcgaccga caatgacgcc      5760
     atcggtcttg tgttctccta tcaggacgcc cagaaccatt accgcctgac cttcaacggc      5820
     aagaccaacc ggcgcgaact cgtcaaggtc aaggacggcg tcgagaccgt gctcgcctcc      5880
     gcggccaagg gccagccctt ccagaccgac atggcggtga aggtcgcggt tctcgacggc      5940
     aagatcagcg ccttcctcaa tggaagctcg atcttcgacg gcgtcgtcaa ggatgccacc      6000
     gatccgctta aagggggtac ggtcggcctc tattcgagcg agcagcgctc ctcgatgttc      6060
     gatgatctcg tcgtcaccaa ggtcaaggcg ctggcgcatg ccggtgcgga tcagcgggcg      6120
     atcgatttcg acggtgacgg tctggcttcc gtccggctcg atgccggtgc ctcgctcggc      6180
     cttgctgaca tcgtcagcta tcgctggacc gatgcgaatg gtgatgaggt cgccaccggc      6240
     attgagccgg aggtgaagct cggcctcggc tccaacgcgc tcacgctgac ggtgaccgac      6300
     gccaacggcg ccacggccac cgaccgcgtc gatatcgatg tgatggccaa gagccaagtg      6360
     ctgctcaacg agagcttcgg ctccgccgag gcgctcgcca agtggcggat ccttgacgag      6420
     ggcgagtccg gaggcgtcgg gcccgatggc aagtcctcgc aatgggaact ccgcgacggc      6480
     cggctcgtgc agctctccga cctgcagagc cgccaactcg aatggcaggg cggggcgact      6540
     gctcccaacc tgtggacgcg cggctggagc cccctcggcg atggcgtgaa cgtcctgcgc      6600
     cgcggcacgc aggcgatcta cgacgatccg gcggcgaagg agtggacgga ttattccgtc      6660
     gaggcgacga tcaagacgct ggacaacgat gcgctcggct tcctcatcca ctatgtggac      6720
     gccaagaact actacaaggt cgagctcgac gcggaaggca attacgatcg caaggcgggc      6780
     aacggcgcgg gcagcctgtt ccagatcacc cgggtgcgcg acggtgtcga ggaggttctc      6840
     tatcaggttc cggccaaata tgagccgggc accgagatgc ggctgcgtgt cgacgtcatc      6900
     ggcggcaaga tctccgcatt cctcgatggc gaggccatct tcgcctatcc gatcgaggac      6960
     cacgcccatc cgaagggcac tgtcgccctc tattcctggg gtagcgaggg cgtcagcttc      7020
     gacgacgtcc gcgtcatcgc gccgggtgag gcagcgcccg gcaacctcca gctttcgggc      7080
     ggggagggcg acgattcgct caccggcagc gccgggaacg acacgatccg gggcggggcc      7140
     ggcaacgaca ccctgaaggg ctttgcgggt gccgaccagc tcttcgggca gaacgggaac      7200
     gacacggtgt ggggcggagc cggcaacgac ttcgtctcgg gcggcttcgg ggccgacagc      7260
     gtctcgggcg atgccggcga cgatctcgtc ttcagcgacg acgatgatga tgtcgcggat      7320
     ggcggggcgg gcaacgaccg cgtctatggc ggcaccggcg ccgacctcgt cttcggcgcg      7380
     gccggtgacg accaagtcta tggcgagtgg ggcaacgact tcgtcagcgg cggcgagggc      7440
     cacgacttcg tctcgggcgg cttcggcaac gacgaggtga atggggatgc cggcaacgac      7500
     ctgctcttcg gcgacgacgg cgacgatgcg gtctcgggcg gggagggcga tgaccgcgtc      7560
     tatggcggca ccggcaacga cctggtgagc ggggaggcgg gcgccgacca ggtgttcggc      7620
     gagcagggtg aggacgtgct gctgggcggg gcgggctcgg actacctatc gggcggggcg      7680
     ggcgccgacc agctgttcgg gggcgagggc gcggacctgt tgttcggcaa tgcgggcgcc      7740
     gacgcgctga cggggggcct tgggtccgac gcattcgcgt tcgggcgcgg ggacggtcag      7800
     gacgtgatcc gggacttcgt gaccgggggc gcggagcggg acgtgatcgc gttcaacaac      7860
     ggcgcgttcg ggtcgtttgc ggcggtgcag gcggcgctgc ggcaggaggg ctcggatgcg      7920
     gtgatcgcct acggcacggg cgacacgatc acgctgcaga acgtgcaggc gaccagcctc      7980
     accgcccaga acttcacctt cgcctga                                          8007
//

If you have problems or comments...

PBIL Back to PBIL home page