(data stored in ACNUC7421 zone)

EMBL: CP001349.PE475

CP001349.PE475       Location/Qualifiers
FT   CDS_pept        548032..548916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0485"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_1695 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55527"
FT                   /db_xref="GOA:B8ICD9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55527.1"
FT                   /translation="MSISKLRAFHLVASAGGFTQAARQASVSQSGLSGQVRELEAASGL
FT                   HLFDRKPRGAVLSENGRELFAITTRLFEAEAEAQRFLRRAPRDGEAGHLRVAGDGPIVP
FT                   LAILQALKRSRPQLTFSLVIDNSDRVVEQVQNFRADVGVTATRPDTDQLHGVYLMSMKI
FT                   GLCVSRSHPLAGRRIAMRDLAGLALVLRERGSRTRAVLEANLAEHGVETGPVLEISTRD
FT                   GIREAVAGGLGCGVVADREFGHDSRLAFVPIVDARIGIDEYAITLAERRNQPLVRAFFD
FT                   GARSWRSEPPEMA"
     atgtcgatca gcaaactccg ggccttccac ctcgtcgcca gcgccggagg cttcacccaa        60
     gcggcccgcc aggcctcggt gagccagtca gggctctccg gtcaggtccg cgagctggaa       120
     gcggcctcgg gtctccatct cttcgaccgc aagccgcgcg gcgccgtgct cagcgagaac       180
     ggccgggagc tgttcgcgat caccacccgc ctgttcgagg ccgaggcgga agcccagcgc       240
     ttcctgcgcc gcgccccgcg cgacggcgag gccggccatc tgcgcgtcgc cggcgacggg       300
     ccgatcgtgc cgctcgccat tctccaggcg ctgaagcgga gccggccgca gctcaccttc       360
     tcgctcgtga tcgacaattc cgaccgcgtt gtcgaacagg tgcagaactt ccgggccgat       420
     gtcggggtga cggcgacccg gccggacacc gatcagctcc acggcgtcta tctgatgtcg       480
     atgaagatcg gcctgtgcgt gtcgcgcagc catccgctcg ccgggcggcg catcgcgatg       540
     cgcgatctcg ccggcctcgc tctcgtcctg cgcgagcgcg gctcgcgcac ccgggcggtg       600
     ctggaggcca atctcgccga gcacggcgtc gagaccggcc cggtcctgga aatctcgacg       660
     cgcgacggca tccgcgaggc ggtcgccggc gggctcggct gcggggtggt cgccgaccgg       720
     gaattcggcc acgattcccg cctcgccttc gtgccgatcg tcgatgcccg gatcggcatc       780
     gacgaatatg ccatcacgct cgccgagcgg cgcaaccagc cgctggtccg ggccttcttc       840
     gacggcgcac gaagctggcg cagcgagcct ccggagatgg catga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page