(data stored in ACNUC7421 zone)

EMBL: CP001349.PE477

CP001349.PE477       Location/Qualifiers
FT   CDS_pept        complement(550190..551212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0487"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: met:M446_1693 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55529"
FT                   /db_xref="GOA:B8ICE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL55529.1"
FT                   /translation="MPLLEIENLSVEFPSAGGVMRAVDGVSLSLEAGEVLGVVGESGSG
FT                   KSVTMLALMGLVAYPGRVRADRLRFEGRDLLTLSARERRRLTGKDVAMIFQEPTTSLNP
FT                   CFTVGFQLAETLRLHEGMGRRAARDRAVELLAQVGIPAPESRLGAYPHQLSGGMNQRVM
FT                   IAMAIACNPKLLIADEPTTALDVTIQAQILDLLLTLQRERGMALVLITHNMGVVAETAQ
FT                   RVIVMYAGQVMEEQKAAALFAAPQHPYTAALLAALPERSEGGRLATIPGVVPGLFDRPS
FT                   GCLFSPRCTDATEHSRRVRPELRACGEGRVRCHYPLGDPQRTARIAEDGRVGATEAVTS
FT                   "
     gtgcccctcc tcgagatcga gaatctctcc gtcgagttcc cgagcgcggg cggcgtgatg        60
     cgcgccgtcg acggggtctc gctcagcctc gaagcgggcg aggtgctcgg cgtcgtcggc       120
     gaatcgggct ccggcaagag cgtcaccatg ctggcgctga tggggctcgt cgcctatccg       180
     ggccgggtgc gcgccgaccg cctgcgcttc gagggccgcg atctcctcac gctgtcggcc       240
     cgcgagcgcc gtcgcctcac cggcaaggac gtcgcgatga tcttccagga gccgacgacg       300
     agcctcaatc cctgcttcac ggtcggcttc cagctcgccg agaccctgcg gctgcacgag       360
     gggatgggcc ggcgggcggc ccgcgaccgg gcggtggagc tgctcgcgca ggtgggcatt       420
     ccggcgcccg agagccgcct cggcgcctat ccgcaccagc tctcgggcgg catgaaccag       480
     cgggtgatga tcgccatggc gatcgcctgc aacccgaagc tgctgatcgc cgacgagccg       540
     acgacggcgc tcgacgtcac catccaggcc cagatcctcg acctgctgct caccctgcag       600
     cgggagcgcg gcatggccct cgtgctcatc acccacaata tgggcgtggt ggccgagacg       660
     gcgcagcgcg tgatcgtgat gtatgcgggc caggtgatgg aggagcagaa agccgccgcg       720
     ctgttcgcgg cgccccagca cccctacacg gcggcgctcc tcgcggccct gccggagcgc       780
     agcgagggcg ggcggctcgc cacgattccc ggcgtggtgc cggggctctt cgatcggcct       840
     tccggctgcc tgttcagccc gcgctgcacc gacgcgaccg agcattcgcg ccgggtgcgc       900
     ccggagctgc gcgcctgcgg cgagggcagg gtgcgctgcc actatccgct cggcgacccg       960
     cagcgcacgg cgcgcatcgc agaggacggg cgggtcggcg ccaccgaggc ggtgacgtcg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page