(data stored in ACNUC7421 zone)

EMBL: CP001349.PE478

CP001349.PE478       Location/Qualifiers
FT   CDS_pept        complement(551217..552128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0488"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1692
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55530"
FT                   /db_xref="GOA:B8ICE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55530.1"
FT                   /translation="MTAEVMETPSAAAPSATPPHPLKEFWSYFRANTGAVIGLAVIVLV
FT                   LALAALADVVAPHSPTLTNEAMFLKPPFWQQGGSLAYPLGTDAIGRDILSRLIHGARLS
FT                   LTIGIAVVALSILVGTALGLAAGYFRGIVDIAIMRVMDIILTLPSLLLAIVIVAILGPG
FT                   LMNAMLAVAVVVLPHYVRIARAAVLAEASRDYVTAAKVSGAGTLRLMFKEILPNCMAPL
FT                   IVQASLGISTAILDAAALGFLGLGAQPPAPEWGTMLADAREFVLRAWWVVTFPGLMILI
FT                   TVLAFNLLGDGLRDAFDPKLKR"
     atgaccgccg aggtgatgga gaccccttcc gccgccgccc caagcgcgac gccgccgcac        60
     ccgctgaagg aattctggtc ctatttccgg gccaatacgg gcgcggtgat cgggcttgcg       120
     gtgatcgtgc tggtgctcgc cctggcggcg ctcgcggacg tggtggcgcc gcactcgccc       180
     accctcacca acgaggcgat gttcctgaag ccgccgttct ggcagcaggg gggctcgctc       240
     gcctatccgc tcggcaccga cgcgatcggg cgggacatcc tctcgcggct gatccacggg       300
     gcgcggctct cgctcaccat cggcatcgcg gtggtcgcgc tctcgatcct ggtcggcacc       360
     gcgctcgggc tcgcggcggg ctatttccgc gggatcgtcg acatcgcgat catgcgggtg       420
     atggatatca tcctcaccct gccgagcctg ctgctcgcca tcgtcatcgt ggcgatcctc       480
     gggcccgggc tgatgaacgc catgctggcg gtcgccgtgg tggtcctgcc ccattacgtg       540
     cgcatcgccc gcgcggcggt gctggccgag gcgtcgcggg actacgtgac cgccgcgaag       600
     gtcagcgggg cggggacgct gcggctgatg ttcaaggaga tcctgccgaa ctgcatggcg       660
     ccgctgatcg tccaggcgtc gctcggcatc tcgacggcga tcctcgacgc agcggccctc       720
     ggcttcctcg gcctcggcgc ccagccgccc gcccccgaat ggggcacgat gctggccgat       780
     gcccgcgaat tcgtgctgcg ggcgtggtgg gtcgtcacct ttcccgggct catgatcctt       840
     atcaccgtgc tggccttcaa cctcctgggc gacggcctgc gcgacgcctt cgaccccaag       900
     ctgaagcggt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page