(data stored in ACNUC7421 zone)

EMBL: CP001349.PE479

CP001349.PE479       Location/Qualifiers
FT   CDS_pept        complement(552169..553179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0489"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1691 alkaline
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55531"
FT                   /db_xref="GOA:B8ICE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55531.1"
FT                   /translation="MLRFLLTRLSLIVPTFIGITLVAFFLIRLVPGDPIETMAGERGID
FT                   PARHEALRHELGLDRPILVQYGIYLGRLLQGDLGKSMITQETVINEFASLFPATVELAV
FT                   CAILFAVLLGLPAGILAAVRRNSIFDHGVMGLSLAGYSMPIFWWGLLLILLFSVQLDLT
FT                   PVSGRIAVQYYVEPVTGFLLIDSLLSDDRGAFGSALAHLVLPAIVLGTVPLAVIARMTR
FT                   SAMLEVLGEDYIRTARAKGLSGMRVIGLHALRNALIPVVTVIGLQVGVLFTGAILTETI
FT                   FSWPGIGKWLIEAIGRRDYPVLQGGILLIGAVVMTVNLLVDLAYGLINPRIRHMR"
     atgctgcgct tcctcctcac ccgcctcagc ctgatcgtgc cgaccttcat cggcatcacg        60
     ctggtcgcct tcttcctgat ccgcctcgtc ccgggcgatc cgatcgagac catggcgggc       120
     gagcgcggca tcgatccggc ccgccacgag gccctgcgcc acgagctcgg cctcgaccgg       180
     ccgatcctgg tccagtacgg gatctatctc ggacgcctgc tccagggcga tctcggcaag       240
     tcgatgatca cgcaggagac cgtgatcaac gaattcgcca gcctgtttcc tgccacggtc       300
     gagctcgcgg tctgcgccat cctgttcgcc gtgctgctcg gccttccggc cggcatcctg       360
     gcggcggtca ggcgcaactc catcttcgac cacggggtga tggggctctc gctcgccggc       420
     tactcgatgc cgatcttctg gtggggcctg ctcctcatcc tgctgttctc ggtgcagctc       480
     gacctcacgc cggtctcggg ccgcatcgcc gtgcagtatt acgtcgagcc ggtgaccggc       540
     ttcctcctga tcgacagcct gctctcggac gacaggggcg ccttcggctc ggcgctcgcc       600
     catctggtgc tgccggccat cgtgctcggc acggtgccgc tggcggtgat cgcgcgcatg       660
     acccgctcgg ccatgctgga ggtgctgggc gaggactaca tccgcaccgc ccgggcgaag       720
     gggctctcag ggatgcgcgt catcgggctg cacgccctgc gcaacgccct catcccggtc       780
     gtgaccgtga tcggcctgca ggtcggcgtg ctgttcacgg gcgcgatcct gaccgagacc       840
     atcttttcct ggccgggcat cggcaagtgg ctgatcgagg cgatcggccg gcgcgactac       900
     ccggtgctcc agggcggcat cctgctcatc ggcgccgtgg tgatgacggt gaacctcctc       960
     gtcgatctcg cctacggcct catcaacccg cgcatccggc acatgcgatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page