(data stored in ACNUC7421 zone)

EMBL: CP001349.PE48

CP001349.PE48        Location/Qualifiers
FT   CDS_pept        complement(54826..56358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0049"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mex:Mext_2140 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55100"
FT                   /db_xref="GOA:B8IU55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU55"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55100.1"
FT                   /translation="MAEDAGRTIEALMRAGAEGATALDAPGGTPLSFGALRALMRRIVQ
FT                   DLNAHGVGRGDRVAIVLDNGPAMAAAFIAIAAGATSAPLNPTYRAEEFEFYLTDLKARV
FT                   LVTAEGSTSPAIAVAEKLGVPVVRLRETPEHGAGSFTLRFPAPAAPAAQGGPAEPGDVA
FT                   LVLHTSGTTSRPKIVPLTQCNVCASARNIRTALAFGPQDRGLNIMPLFHIHGLIAGILA
FT                   PLSAGGSVACTPGFNALKFFAWMDEVGPTWYTAVPTMHQAILARAGRNREIIARHPLRF
FT                   LRSSSSSMPPQVLRELEAVFDAPLIEAYGMTEAAHQMASNPLPPRARKAGSVGLAAGPD
FT                   IQVVDEAGNPLPAGETGEIVIRGDNVMAGYENNPKANAEAFTPQGYFRTGDQGVMDEEG
FT                   YLAITGRLKEIINRGGEKISPREVDEILMDHPSVAQVVTFAVPHDKLGEEVGAAVVLRD
FT                   GQHVDDKELRAFVAERAAAFKVPSRIMILDEIPKGATGKLQRIGLARKLGLA"
     atggccgagg atgcgggccg cacgatcgag gccctgatgc gggcgggcgc ggagggcgcg        60
     accgccctcg acgcgcccgg aggcacgccg ctgagcttcg gggcgctgcg tgccctgatg       120
     cggcgcatcg tacaggacct caatgcccac ggggtcgggc gcggcgaccg ggtggcgatc       180
     gtgctcgaca acggcccggc catggcggcg gccttcatcg cgatcgccgc cggcgccacc       240
     tcggcaccgc tcaatccgac ctaccgggcc gaggagttcg agttctacct caccgacctc       300
     aaggcccggg tgctggtgac ggcggagggc agcacctcgc ccgccatcgc ggtggcggag       360
     aagctcggcg tgccggtagt gcgcctgcgc gagacccccg agcacggggc cggctccttc       420
     acgctccggt tcccggcacc ggccgcgccc gccgcgcagg gcggcccggc ggagcccggc       480
     gacgtggcgc tggtgctcca tacctcgggc acgacctcgc ggcccaagat cgtgccgctg       540
     acgcagtgca atgtctgcgc ctcggcccgc aacatccgga ccgcgctcgc cttcgggccg       600
     caggaccgcg gcctcaacat catgccgctg ttccacatcc acgggctcat cgccggcatc       660
     ctggcgccgc tctcggcggg cggctcggtc gcctgcacgc ccggcttcaa cgcgctcaag       720
     ttcttcgcct ggatggatga ggtcggcccc acctggtaca cggccgtgcc gaccatgcac       780
     caggccatcc tcgcccgggc cgggcgcaac cgcgagatca tcgcgcgcca ccccctgcgc       840
     ttcctgcgct cctcctcctc gtccatgccg ccgcaggtgc tgcgcgagct ggaggcggtg       900
     ttcgatgcgc ccctgatcga ggcctacggg atgaccgagg ccgcccacca gatggcctcg       960
     aacccgctgc cgccccgcgc ccgcaaggcc ggctccgtcg gcctggccgc cgggccggac      1020
     atccaggtgg tggacgaggc cggcaacccg ctgcccgcgg gcgagaccgg cgagatcgtc      1080
     atccgcggcg acaacgtcat ggcgggctac gagaacaacc cgaaggccaa tgcggaggcc      1140
     ttcacgccgc agggctattt ccgcaccggc gaccagggcg tgatggatga ggagggctac      1200
     ctcgccatca ccgggcgcct gaaggagatc atcaaccggg gcggcgaaaa aatctcgccg      1260
     cgcgaggtcg acgagatcct gatggaccat ccgtcggtgg cgcaggtcgt caccttcgcg      1320
     gtgccccacg acaagctcgg cgaggaggtc ggcgccgcgg tggtcctgcg cgacggccag      1380
     cacgtggacg acaaggagtt gcgcgccttc gtggccgagc gcgccgccgc cttcaaggtc      1440
     ccgagccgga tcatgatcct cgatgagatc cccaagggcg cgaccggcaa gctgcagcgc      1500
     atcggcctcg cgcggaagct ggggctggcg tag                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page