(data stored in ACNUC7421 zone)

EMBL: CP001349.PE480

CP001349.PE480       Location/Qualifiers
FT   CDS_pept        complement(553225..554820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0490"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1690 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55532"
FT                   /db_xref="GOA:B8ICE4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE4"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55532.1"
FT                   /translation="MKTTILLAAVAGAAVLAAPLQAKTLVYCSEGSPENFYPAINTTGT
FT                   TFDATAQVYNNLVEFERGGTKVVPGLAESWEISPDGTAYTFHLRKGVKWHNANRAFKPT
FT                   RDFNADDVVFAIERQWKEDHPFYKVTSSNHSYFNDMGLAKLLKSVERLDDHTVRITLNR
FT                   PEAPFLADLAMSYAGIQSKEYADAMLKAGTPEKIDQVPIGTGPFYLVQYQKDAIIRYKA
FT                   FPEYWGGKAKIDDLVFAITPDASVRWAKLQKGECHLMPYPNPADLDAMRKDPAIQVLEQ
FT                   PGLNIGYLAYNTTKKPFDDVRVRKAFNMAINKKAIIEAVYLSTGIAAVNPIPPSIWSYN
FT                   TAVKDDPYDPEAARKLLAEAGFPNGFETDLWAMPVQRPYNPNARRIAELMQADLAKVGI
FT                   KAEIKSYEWGEYRKRMQAGEHQTGMLGWTGDNGDPDNFLHTLLGCDAAKNNGGNVAKWC
FT                   DKTFDDVVVKAKMLTDQAERTKLYEQAQVVFKEQAPWFTIAHAVQLKPMRKEVIDFKLS
FT                   PFSRHVFYGVDIKG"
     gtgaagacaa ccatcctgct cgccgccgtc gccggcgcgg ccgtcctggc cgcccccctt        60
     caggccaaga ccctggtcta ttgctcggaa ggctcgccgg agaatttcta tccggcgatc       120
     aacaccacgg gcacgacctt cgacgcgacc gcccaggtct acaacaatct ggtcgagttc       180
     gaacgcggcg gcaccaaggt ggtgccgggc ctggccgaga gctgggagat ctcgccggac       240
     ggcacggcct acaccttcca cctgcgcaag ggcgtgaaat ggcacaatgc caaccgcgcc       300
     ttcaagccga cccgcgactt caacgccgac gacgtcgtgt tcgccatcga gcggcagtgg       360
     aaggaggatc atcccttcta caaggtcacc agctcgaacc actcctactt caacgacatg       420
     gggctggcga agctgctgaa gtcggtggag aggctcgacg atcacaccgt ccgcatcacg       480
     ctcaaccggc ccgaggcgcc gttcctcgcc gacctcgcca tgtcctacgc agggatccag       540
     tcgaaggaat acgccgatgc catgctgaag gccggcaccc cggagaagat cgaccaggtc       600
     ccgatcggaa ccgggccgtt ctacctcgtg cagtaccaga aggacgcgat catccgctac       660
     aaggccttcc ccgaatactg gggtggaaag gccaagatcg acgacctcgt gttcgcaatc       720
     acgccggatg cgtccgtccg ctgggcgaag ctgcagaagg gcgaatgcca cctgatgccc       780
     tatccgaacc cggccgacct cgatgccatg cgcaaggatc cggcgattca ggtgctggag       840
     cagccgggcc tcaacatcgg ctatctcgcc tacaacacga ccaagaagcc cttcgacgac       900
     gtgcgcgtgc gcaaggcctt caacatggcc atcaacaaga aggccatcat cgaggcggtc       960
     tatctctcga ccggcatcgc ggcggtgaac ccgatcccgc cctcgatatg gtcctacaac      1020
     acggcggtga aggatgatcc ctacgatccg gaggcggcga ggaagctcct cgccgaggcc      1080
     ggcttcccga acgggttcga gaccgatctc tgggcgatgc cggtgcagcg cccctacaac      1140
     cccaatgcaa ggcgtatcgc cgagctgatg caggccgatc tcgccaaggt cggcatcaag      1200
     gccgagatca agtcctacga gtggggcgag taccgcaagc gcatgcaggc gggcgagcac      1260
     cagaccggga tgctcggctg gaccggcgac aacggcgatc cggacaactt cctgcacacg      1320
     ctgctcggct gcgacgccgc caagaacaat ggcggcaacg tcgccaaatg gtgcgacaag      1380
     accttcgacg acgttgtggt caaggccaag atgctgaccg atcaggccga gcgcaccaag      1440
     ctctacgaac aggcccaggt cgtgttcaag gagcaggccc cctggttcac catcgcgcat      1500
     gcggtgcagc tgaagccgat gcgcaaggag gtgatcgact tcaagctgtc gcccttcagc      1560
     cgccacgtct tctacggcgt ggacatcaag ggctaa                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page