(data stored in ACNUC7421 zone)

EMBL: CP001349.PE481

CP001349.PE481       Location/Qualifiers
FT   CDS_pept        555014..557503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0491"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: met:M446_1689 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT domain
FT                   protein; NAD-dependent DNA ligase OB-fold; NAD-dependent
FT                   DNA ligase adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1; NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55533"
FT                   /db_xref="GOA:B8ICE5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICE5"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACL55533.1"
FT                   /translation="MPAQTSRARPVEEMTAAQAREAHESLSAEIAEHDRRYHGEDAPII
FT                   SDAEYDALRRRLEAIEERFPELAGTGAASVSVGAKASDKFAKVRHAVPMLSLGNAFAEE
FT                   EITEFVERVRRFLGLPASEPLAFTAEPKIDGLSLSLRYEGGRLVTAATRGDGEVGEDVT
FT                   ANVRTIREIPHELAGDDVPEICEVRGEVYLSHADFAAINARQEEAGRPLFANPRNAAAG
FT                   SLRQLDPGITASRPLRFFAYAAGEMSSWPAETQSGLIGAFRRFGLPVNPRTKRCTSVAE
FT                   MLAHYRAIETERAELGYDIDGVVYKVDEFALQRRLGFVARAPRWALAHKFPAQRAVTVI
FT                   EAIEINVGRTGSLNPLARLKPVTVGGVVVSNATLHNEDYIRGIDADGNTIRSGINIWDG
FT                   FRLREDVDLRQGSDVRVGDTVVVLRAGDVIPKVADVVLERRPADAVPYAFPETCPACGS
FT                   HAVRAYNPRTGKLDSVRRCTGGLICPAQGQERLRHFVSRNAFDIEGFGETYIATLFEAG
FT                   LVRQPADLFRLDFEPLKAAIVARRQALSAERALAAGKTPEAKKAKPKANEEDKAIHNLL
FT                   AAVEARRTIPLNRFIFALGIEQVGEATAKALAKHFPDMPALMEGVRAAAACRPGPDWIE
FT                   LASLPRVGPTTRERLLAAAEAGETDLLADGAVTRLTSAQKEALLAAYGDRDGLRNAVER
FT                   ALRQKPGDAYRHLADDSEIGAVTTASLIEFFSEAHNVEAVEALLREVRTERAGTPAAAA
FT                   VFSGQTVVFTGSLERMTRSEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKH
FT                   GVRVISEAEWLAMVEAA"
     atgcccgcac agacgtcccg cgcccgcccc gtggaggaaa tgaccgccgc gcaagcccgg        60
     gaggcgcacg aatccctctc ggcggagatc gccgagcacg atcggcgcta ccacggcgaa       120
     gacgcgccca tcatctcgga cgccgaatac gacgccctgc ggcgtcgcct agaggcgatc       180
     gaggagcgct tccccgagct tgccggcacc ggcgcggcct ccgtgagcgt cggcgccaag       240
     gcctccgaca agttcgccaa ggtgcgccac gccgtgccga tgctctcgct cggcaacgcc       300
     ttcgcggagg aggagatcac cgagttcgtc gagcgcgtgc gccgcttcct cggcctgccg       360
     gcctccgagc ccctcgcctt cacggccgag ccgaagatcg acgggctctc gctgtcgctg       420
     cgctacgagg gcgggcgcct cgtcaccgcc gcgacccgcg gcgacggcga ggtgggcgag       480
     gacgtcaccg ccaacgtgcg caccatccgg gagatcccgc acgaactcgc cggagacgac       540
     gtgcctgaga tctgcgaggt gcgcggcgag gtctatctct cgcatgcgga tttcgccgcc       600
     atcaacgcgc gccaagagga ggcgggcagg cccctcttcg ccaatccgcg caatgccgcg       660
     gccgggtcgc tccgccagct cgatccgggc atcaccgcct cgcgcccgct gcgtttcttc       720
     gcctatgcgg caggcgagat gtcctcctgg ccggccgaga cccagagcgg gctgatcggg       780
     gccttccggc ggttcggcct gccggtgaat ccgcgcacga agcgctgcac cagcgtcgcc       840
     gagatgctgg cgcattaccg cgccatcgag accgagcggg cggagctcgg ctacgacatc       900
     gacggcgtcg tctacaaggt ggacgagttc gcgctgcagc gccggctcgg cttcgtcgcc       960
     cgcgccccgc gctgggccct cgcccacaag ttcccggccc agcgcgccgt cacggtgatc      1020
     gaggcgatcg agatcaatgt cgggcgcacg ggctcgctca acccgctcgc gcgcctcaag      1080
     ccggtcacgg tggggggcgt cgtggtgtcc aacgcgacgc tccacaacga ggattacatc      1140
     cgcggcatcg acgcggacgg gaacacgatc cgcagcggca tcaacatctg ggacgggttc      1200
     cggctgcgcg aggacgtcga cctgcggcag ggctcggacg tgcgggtcgg cgacaccgtg      1260
     gtggtgctgc gcgcagggga cgtgatcccg aaggtcgccg acgtggtgct ggagcgccgc      1320
     ccggccgatg cggtgccgta tgccttcccg gagacctgcc cggcctgcgg cagccatgcg      1380
     gtgcgcgcct acaatccccg caccggcaag ctcgattccg tgcgccgctg caccggcggc      1440
     ctgatctgcc cggcgcaggg gcaggagcgg ctcaggcact tcgtctcgcg caacgccttc      1500
     gacatcgagg ggttcggcga gacctacatc gccaccctgt tcgaggccgg gctcgtgcgc      1560
     cagcccgccg acctgtttcg gctggatttc gagcccctga aggcggccat cgtggcgcgg      1620
     cgccaggcgc tctccgccga gcgggcgctc gcggccggca agacgccgga ggccaagaag      1680
     gccaagccca aggcgaacga ggaggacaag gcgatccaca acctcctcgc cgccgtcgag      1740
     gcgcgccgga cgatcccgct caaccggttc atcttcgcgc tcggcatcga gcaggtcggc      1800
     gaggcgaccg ccaaggcgct ggccaagcat tttcccgata tgcccgccct gatggagggc      1860
     gtgcgggcgg ccgccgcctg ccggccgggg ccggactgga tcgagcttgc gagcctgccg      1920
     cgggtcggtc cgaccacgcg cgagcggctc ctcgccgcgg ccgaggccgg cgagaccgac      1980
     ctcctcgccg atggcgcggt gacgcggctc acctccgccc agaaggaggc gctgctcgcc      2040
     gcctacggtg atcgggatgg cctgcgcaac gcggtggagc gggcgctccg ccagaagccc      2100
     ggcgacgcct accgccacct cgcggatgac agcgagatcg gggcggtgac gacggcctcc      2160
     ctgatcgagt tcttctcgga ggcccacaac gtcgaggcgg tggaggccct gctgcgcgag      2220
     gtccggacgg aacgggccgg tacgcccgcc gctgccgccg tgttcagcgg gcagacggtg      2280
     gtgttcacgg gctcgctcga acgcatgacc cgcagcgagg ccaaggcgac ggccgagcgc      2340
     cttggtgcga aggtctcggg ctcggtctcc gccaagaccg acctcgtcgt cgcggggccg      2400
     ggcgccggct cgaagctgaa ggacgccgag aagcacggcg tgcgcgtcat ctccgaggcg      2460
     gaatggctgg cgatggtgga ggccgcctga                                       2490
//

If you have problems or comments...

PBIL Back to PBIL home page