(data stored in ACNUC7421 zone)

EMBL: CP001349.PE482

CP001349.PE482       Location/Qualifiers
FT   CDS_pept        557536..558105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0492"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: met:M446_1688 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55534"
FT                   /db_xref="GOA:B8ICE6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE6"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACL55534.1"
FT                   /translation="MRTLAIDFETANERRDSACAVGLAWIEDGRVVRREARLIRPAEMR
FT                   FSPFNVRVHGIRPEDVADAPDFAAAMAPFLPEIAGALVLAHNASFDIGVLAAALAACGL
FT                   PQPDYTSLCTLQLARRQWPGQERYRLPALAARLGIAFRHHDAGEDAFVCAEVALAAMRE
FT                   AGAPDVATLAHASGLARRRGGLPLGA"
     atgcgaacgc tcgcgatcga tttcgaaacg gcgaatgagc gccgggacag cgcctgcgcg        60
     gtcggcctcg cctggatcga ggacgggcgc gtggtgcgcc gcgaagcccg cctgatccgc       120
     ccggccgaga tgcgcttctc gcccttcaac gtccgcgtcc acggcatccg cccggaggac       180
     gtggcggatg cgccggattt tgccgccgcg atggcgccct tcctgcccga gatcgcgggc       240
     gcgctggtgc tcgcccacaa tgcgagcttc gacatcggcg tgctcgccgc ggcgctcgcg       300
     gcctgcgggt tgccgcagcc ggactacacg tcgctgtgca cgctccagct cgcccggcgg       360
     caatggcccg gtcaggagcg ctaccggctt ccggccctgg ccgcgcggct cggcatcgcc       420
     ttccgccacc acgatgccgg ggaggatgcc ttcgtctgcg cggaagtggc gctcgccgcc       480
     atgcgcgagg cgggagcgcc ggacgtcgcg acgctcgccc atgcgtcggg cctcgcccgg       540
     cggcgcggcg ggctgcccct cggtgcctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page