(data stored in ACNUC7421 zone)

EMBL: CP001349.PE483

CP001349.PE483       Location/Qualifiers
FT   CDS_pept        558449..559831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0493"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   met:M446_1685 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55535"
FT                   /db_xref="GOA:B8ICE7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE7"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACL55535.1"
FT                   /translation="MTPSTTFAGRTLALFGLGGSGLATALSLQAGGARVVACDDNPERM
FT                   AAAEAEGVATADLRGADWAEFAALLLAPGVPFTHPEPHWTVKRAASAGVPVIGDIELFC
FT                   RERATTAPDAPFVAITGTNGKSTTTALIAHVLRETGHDVQMGGNIGTAILSLAPPAPGR
FT                   VHVIEMSSFQIDLTPTLKPSVGVLLNITPDHLDRHGDMANYAGIKERLIASSDHAVIGV
FT                   DDDYTRAIAARHAGPLTRVHVGETAPGPGILARHGVLIDGCTEPPSPVADLTGIPSLRG
FT                   SHNWQNAGIAYAVARALGVAPDAFAQALRSFPGLPHRMEEVGRRGSVLFINDSKATNAD
FT                   STEKALAAFPRVHWILGGKPKEGGIASLAPYFPRIAHAYLIGAASDAFAATLEGHAPVS
FT                   RCGTLEAAVAQAAEDAAHEPEAVVLLSPACASYDQFRSFEDRGDQFRAMVRALPGLVPT
FT                   GG"
     atgacgccca gcaccacctt cgccggccgc accctcgctc tgttcggcct cggcggctcg        60
     ggcctcgcca ccgcgctgag cctccaggcg ggcggcgccc gggtcgtcgc ctgcgacgac       120
     aatccggagc gcatggcggc ggccgaggct gagggcgtcg ctaccgccga tctgcgggga       180
     gccgactggg cggaattcgc ggcgctcctc ctcgcccccg gcgtgccctt cacccatccg       240
     gagccgcact ggacggtcaa gcgcgcggcg agcgcgggcg tgccggtgat cggcgacatc       300
     gagctgttct gccgcgagcg cgccaccacg gccccggacg cccccttcgt cgccatcacg       360
     ggcaccaacg gcaagtcgac caccacggcg ctcatcgccc atgtcctgcg ggagaccggc       420
     cacgacgtgc agatgggcgg caatatcggc acggcgatcc tgtcgctcgc gccgcccgcc       480
     cccggccgcg tccacgtgat cgagatgtcg tcctttcaga tcgacctcac gccgacgctg       540
     aagccgagcg tcggcgtgct cctcaacatc acgcccgacc acctcgaccg ccacggggac       600
     atggccaact acgcgggcat caaggagcgg ctgatcgcga gttccgacca cgcggtgatc       660
     ggggtcgacg acgactacac ccgggcgatc gcggcgcggc atgccgggcc gcttacgcgg       720
     gtgcatgtgg gcgaaaccgc gcccgggccc ggcatcctcg cccgccacgg cgtcctgatc       780
     gacggctgca ccgaaccgcc ctccccggtc gcggatctca ccggcatccc ttccttacgc       840
     ggatcgcaca actggcagaa tgccgggatc gcctatgcgg tggcgcgcgc gctcggggtg       900
     gcgccggacg ccttcgcgca ggccctgcgc agcttccccg gcctgcccca ccggatggag       960
     gaggtggggc ggcgcggctc cgtgctcttc atcaacgact cgaaggcgac caacgccgat      1020
     tcgaccgaga aggcgctggc ggccttcccg cgcgtgcact ggatcctcgg cggcaagccg      1080
     aaggagggcg gcatcgcgag cctcgccccc tatttcccgc gcatcgccca cgcctacctg      1140
     atcggcgccg cgagcgacgc cttcgcggcg acgctggagg ggcacgcgcc cgtcagccgc      1200
     tgcggcacgc tggaagcggc cgtggcgcag gcggccgagg atgcggcgca tgagccggag      1260
     gcggtggtcc tgctctcgcc ggcctgcgcg tcctacgatc agttccgcag cttcgaggat      1320
     cgcggcgacc agttccgggc gatggtgcgg gccctgccgg ggctggtgcc gacgggcggg      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page