(data stored in ACNUC7421 zone)

EMBL: CP001349.PE484

CP001349.PE484       Location/Qualifiers
FT   CDS_pept        559951..560730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0494"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   met:M446_1684 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55536"
FT                   /db_xref="GOA:B8ICE8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACL55536.1"
FT                   /translation="MLNHPHLLPAGGAPIQVPVHRAPRKIISWNLLRRSGATVEAVAAL
FT                   IEHEKPDLLLMQEATVEITDLQERVGGHYAWAPLPRRIHGLAMWSPTPWLSTPRVIPIP
FT                   SGALVDRVCQVLDCGTYGVANVHLSHGQMLNRRQLRRIEQHLPVRAAVLGDYNLVGPAL
FT                   LPGFRDVGPRHPTHAMVEIVPLRLDRCLVRGLICRHTAVLPRGASDHRPIVVHLEPSSL
FT                   PLSRPGIAHLRDRVDLRGMAAAIARRRRAGAPASPLP"
     atgctgaatc acccccatct cctgccggcc ggcggggctc cgatccaggt cccggtgcac        60
     cgtgcgcccc gcaagatcat cagctggaac ctgctgcggc ggagcggggc gacggtggag       120
     gccgtagcgg cgctgatcga gcacgagaag cccgacctgc tgctgatgca ggaggcgacg       180
     gtcgagatca ccgacctgca ggagcgcgtg ggcgggcatt atgcctgggc gcccctgccg       240
     cggcgcatcc acgggctggc gatgtggagc ccgacgccct ggcttagcac cccgcgggtg       300
     atcccgatcc cgtccggcgc cctggtcgac cgcgtctgcc aggtgctcga ttgcggcacc       360
     tacggggttg ccaacgtcca cctctcgcac gggcagatgc tcaaccggcg ccagctgcga       420
     cgcatcgagc agcacctgcc ggtgcgcgcc gccgtcctcg gggactacaa tctcgtcggg       480
     ccggccctgc tgccgggctt ccgggatgtg gggccgcgtc atccgaccca cgcgatggtg       540
     gagatcgttc ccctgcgcct cgaccgctgc ctcgtgcgcg gcctgatctg ccggcacacg       600
     gcggtgctgc cgcggggcgc ctcggaccac cggccgatcg tggtgcatct ggagccctca       660
     tctctgcccc tcagccgccc cgggatcgcg catctgcgcg accgcgtcga cctcagaggt       720
     atggcagcag caatcgcacg ccggcgtcgc gcaggcgcac cggcatcccc cttgccttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page