(data stored in ACNUC7421 zone)

EMBL: CP001349.PE485

CP001349.PE485       Location/Qualifiers
FT   CDS_pept        complement(560663..562099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0495"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   met:M446_1683 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55537"
FT                   /db_xref="GOA:B8ICE9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE9"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACL55537.1"
FT                   /translation="MQELVTAWFGLLSAVRVEGLALLGFALAFAVTLHALLNKREVGAA
FT                   IGWIGLAWLSPLAGSALYALFGINRVMRRARRLPVLPVRKPGVPQADPVRVPEPFLPLE
FT                   RAGDELTGLPLTGGNRVALLRHGDEAYPAMLEAIGTAQHSIGLSSYIMRDDASGEAFVR
FT                   ALAAAKARGTAICVLVDGIGSGYFSPAIYRRLRAEGIPAGLFMHSAVPWRMPFLNLRTH
FT                   KKLLVVDGRIGFVGGVNIGDENRVSQNPPEPVRDTHFRLDGPVVGQLTQAFARDWAFVM
FT                   GEDLDGPAWFPAIPPAGAIPARVVTSGPDADIEKIEFVVLAALATARRSIRLATPYFLP
FT                   SEILLTSLALAAMRGIAVDVVIPQASNHRLVDWATRAHVGPLLKSGVRIWLDRPPFDHS
FT                   KLMVVDDVWCFVGSANWDTRSFRLNFELNVELYDPAFAAQLDRLLAAKMETQLTREALK
FT                   ARGMPVRLRDAGVRLLLPYL"
     gtgcaagagc tggtcaccgc gtggttcgga ttgctcagcg cggtccgggt ggaggggctg        60
     gcgctcctcg gcttcgccct ggccttcgcg gtcaccctgc acgccctcct caacaagcgg       120
     gaggtcgggg cggccatcgg ctggatcggg ctggcctggc tctcgccgct cgccggcagc       180
     gccctctacg cgctgttcgg catcaaccgg gtgatgcgcc gggcgcgccg cctgcccgtg       240
     ctgccggtgc gcaagcccgg cgtgccgcag gccgatcccg tccgggtgcc cgagcccttc       300
     ctgcccctcg aacgggccgg cgacgagctg accgggctgc cgctcaccgg cggcaaccgc       360
     gtggcgctgc tgcgccacgg cgacgaggcc tatccggcga tgctggaggc gatcgggacc       420
     gcgcagcaca gcatcggcct gtcgagctac atcatgcgcg acgatgcgag cggggaggcc       480
     ttcgtgcggg cgctcgccgc cgccaaggcc cggggcaccg cgatctgcgt actcgtcgac       540
     ggcatcggca gcggctattt ctccccggcg atctaccggc gcctgcgggc cgagggcatc       600
     ccggcgggcc tgttcatgca ttccgccgtg ccctggcgca tgcccttcct gaacctgcgc       660
     acgcacaaga agctgctcgt ggtggatggg cggatcggct tcgtcggggg cgtcaatatc       720
     ggggacgaga accgggtgtc gcagaacccg cccgagcccg tgcgcgacac gcatttccgc       780
     ctcgacgggc cggtggtcgg tcagctcacc caggccttcg cccgcgactg ggccttcgtg       840
     atgggcgagg atctcgacgg gccggcatgg ttcccggcga ttccgccggc gggcgccatt       900
     ccggcccggg tcgtcacctc ggggcccgat gccgatatcg agaagatcga attcgtggtg       960
     ctggccgcgc tcgccaccgc ccggcgctcg atccggctcg ccacgcccta tttcctgccg      1020
     agcgagatcc tgctcacctc gctcgcgctc gcggcgatgc gcgggatcgc ggtcgacgtc      1080
     gtcatcccgc aggcgagcaa ccaccggctc gtcgactggg cgacccgcgc gcatgtgggg      1140
     ccgctgctca agtcgggggt gcggatctgg ctcgaccggc cgcccttcga ccattcgaag      1200
     ctgatggtcg tcgacgacgt gtggtgcttc gtcggcagcg ccaactggga cacgcgcagc      1260
     ttccggctca atttcgagct gaacgtcgaa ctctacgatc cggccttcgc ggcgcagctg      1320
     gaccggctgc tcgcggccaa gatggagacg cagctcaccc gcgaggcgct taaggcaagg      1380
     gggatgccgg tgcgcctgcg cgacgccggc gtgcgattgc tgctgccata cctctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page