(data stored in ACNUC7421 zone)

EMBL: CP001349.PE486

CP001349.PE486       Location/Qualifiers
FT   CDS_pept        complement(562242..563528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0496"
FT                   /product="putative glucose/sorbosone dehydrogenase"
FT                   /note="KEGG: met:M446_1682 putative glucose/sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55538"
FT                   /db_xref="GOA:B8ICF0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF0"
FT                   /inference="similar to AA sequence:KEGG:M446_1682"
FT                   /protein_id="ACL55538.1"
FT                   /translation="MRSGLIAALTAGATLAASVSLASLAAAQEAGDTKAKVDNLEKLQG
FT                   FRTTGVAEPPPIPQTGRRADAINRTLQKIKLPEGFKISLYAIVPDARAMAVGPNAGVVF
FT                   VGTRKSKVYTVTDRAKDRVADEVKVFAPAIDFKIPNGVCFSRDGVLTVVEQNRVLAFPA
FT                   AEFFYEGPDVAASVVVKQGELIPVSEESYNHTARVCRIGPDGKLYIALGQPYNVPPKEK
FT                   AELYARTGIGGIIRMDADGKNREVFATGIRNSVGMDFAPDKTLWFTDNQVDGMGDDQPP
FT                   GELNQATKPGQNFGFPWYGGGAVRTVEYKNDTVPPDVVPPKAELAPHAADLGMIVYRGK
FT                   MFPEKYRGGVFTAEHGSWNRTTPIGARVMFVPITKDGTAGRPEPFAEGWLTESGEYLGR
FT                   PVDVATLPDGSLLVSDDTAGAIYRIAYEK"
     atgagatcgg gtctgatcgc ggcgctcacc gcgggcgcca cgctcgccgc gagcgtgtcg        60
     ctcgcgagct tggccgcagc gcaggaggcc ggcgacacca aggccaaggt cgacaacctg       120
     gagaagctgc agggcttcag gacgaccggc gtggccgagc cgccgccgat cccccagacc       180
     ggccggcgcg ccgacgccat caaccgcacc ctgcagaaga tcaagctgcc cgagggcttc       240
     aagatcagcc tctacgccat cgtgcccgat gcccgcgcca tggcggtcgg cccgaatgcc       300
     ggcgtggtct tcgtgggcac ccgcaaatcc aaggtctaca ccgtcaccga ccgggcgaag       360
     gaccgggtgg ccgacgaggt gaaggtcttc gcgcccgcca tcgacttcaa gatcccgaac       420
     ggcgtgtgct tctcgcgcga cggggtgctg accgtggtgg agcagaaccg ggtgctggcc       480
     ttcccggccg ccgagttctt ctacgagggg ccggacgtcg cggcgagcgt ggtggtcaag       540
     cagggcgagc tgatcccggt ctcggaggag agctacaacc acacggcccg ggtctgccgg       600
     atcggacccg acggcaagct ctacatcgcg ctcggccagc cctacaacgt gcccccgaag       660
     gagaaggccg agctctacgc caggaccggc atcggcggca tcatccgcat ggacgccgac       720
     ggcaagaacc gcgaggtgtt cgccaccggc atccgcaatt ccgtcggcat ggatttcgcg       780
     cccgacaaga cgctgtggtt caccgacaac caagtggacg ggatgggcga cgaccagccg       840
     ccgggcgagc tgaaccaggc cacgaagccg ggccagaatt tcggcttccc ctggtacggt       900
     ggcggggcgg tgcgcaccgt cgagtacaag aacgacaccg tgccgcccga cgtggtgccg       960
     ccgaaggccg aactggcgcc gcacgcggcc gatctcggca tgatcgtcta ccggggcaag      1020
     atgtttcccg agaagtaccg gggcggggtg ttcacggccg agcacggctc gtggaaccgc      1080
     accacgccga tcggcgcccg ggtgatgttc gtgcccatca ccaaggacgg caccgccggc      1140
     agacctgagc ccttcgcaga gggctggctg acggagagcg gcgagtatct cgggcggccg      1200
     gtcgatgtcg cgaccctgcc ggacggctcg ctcctcgtct cggacgacac ggcgggtgcg      1260
     atctaccgca tcgcctacga gaaatag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page