(data stored in ACNUC7421 zone)

EMBL: CP001349.PE487

CP001349.PE487       Location/Qualifiers
FT   CDS_pept        complement(563629..565074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0497"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: met:M446_1681 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55539"
FT                   /db_xref="GOA:B8ICF1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF1"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55539.1"
FT                   /translation="MTLPSDLVTLHATDLAQAIRSRAVSAREVMQAHLDQIARFNPAVT
FT                   AIVSLRDPELLLAEAEAADRDLAAGRWRGPLHGLPHAVKDTSPAQGMPWTQGSPVFRSR
FT                   MPEADAPYVARLRQAGAILIGKTNVPEFGLGSHTVNPVFGPTRNAYDPGRSAGGSSGGA
FT                   AVALALRMLPLADGSDHAGSLRNPAAWNGVLGLRPSPGRVPLRTDEVFLPDLTVAGPMA
FT                   RCTADLGLLLSVMAGPDPRLPQAIQEDPAPFARPQPRDLPGLRVGWLGDCGGHLATEPG
FT                   VLDLCEQGLAVLEARGARVEPLALGLDPEEVWQAWRVLRAWLAGGAQAPLWRDPQTRAA
FT                   LKPEAAWEVEEGLKLDAFAILEASAMRSRWYAQVLRLFETVDLLALPAAQVFPFPIEEA
FT                   WPRRIAGRDMDTYHRWMEVTIPATMAGCPAISLPAGRNQGGLPMGLQLIAPHRGEAALL
FT                   SVAAAYEEATAFDRMLPPPLTAP"
     atgactcttc cgtccgatct cgtcaccctg catgccaccg acctcgcgca ggcgatccgc        60
     agccgggccg tctcggcccg cgaggtgatg caggcccatc tcgaccagat cgcgcggttc       120
     aaccccgccg tcaccgcgat cgtctccctg cgcgatcccg agctgctgct ggcggaggcc       180
     gaggccgccg accgcgatct cgccgccggg cgctggcgcg gcccgctcca cggccttccc       240
     cacgcggtga aggatacctc gccggcgcag ggcatgccct ggacccaggg ctcgcccgtc       300
     ttccgcagcc ggatgccgga ggcggatgcg ccctacgtgg cgcgcctgcg gcaggcgggg       360
     gcgatcctga tcggcaagac caacgtcccg gaattcgggc tcggctccca cacggtcaac       420
     ccggtcttcg gcccgacccg caatgcctat gatccgggcc gcagcgcggg cgggtcgagc       480
     gggggcgccg ccgtcgccct ggcgctgcgc atgctgccgc tcgccgatgg cagcgaccat       540
     gccggctcgc tgcgcaaccc cgcggcctgg aacggtgtcc tgggcctgcg cccctcgccc       600
     gggcgggttc ccctgcgcac cgacgaggtc ttcctgccgg acctcaccgt ggcgggcccg       660
     atggcccgct gcaccgccga tctcggcctg ctgctctcgg tgatggcggg tcccgatccg       720
     cgcctgccgc aggcgatcca ggaggatccc gcgccctttg cgcgcccgca gccccgcgac       780
     ctgcccggtc tgcgcgtcgg ctggctcggc gattgcggcg ggcatctcgc gacggagcct       840
     ggcgtcctcg acctctgcga gcagggcctc gccgtgctcg aggcgcgcgg cgcccgggtg       900
     gagccgctgg cgctcggcct cgatccggag gaggtctggc aggcgtggcg ggtgctgcgg       960
     gcttggctcg cgggcggggc gcaggcgccc ctctggcgcg atccgcagac ccgcgcggcg      1020
     ctgaagcccg aggccgcctg ggaggtggag gaggggctca agctcgatgc cttcgccatc      1080
     ctggaggcga gcgccatgcg cagccgctgg tacgcgcagg tgctccgcct gttcgagacg      1140
     gtcgatctgc tggcgctgcc ggccgcccag gtcttcccct tcccgatcga ggaggcgtgg      1200
     ccgcgccgca tcgcggggcg ggacatggac acctatcacc gctggatgga ggtcacgatt      1260
     ccggcgacga tggcgggctg cccggcgatc agcctcccgg ccggccgcaa ccagggcggc      1320
     ctgcccatgg gcctccagct catcgccccg caccggggcg aggccgcgct cctctccgtc      1380
     gccgcggcct acgaggaggc gaccgccttc gaccggatgc tgccgccgcc gctcacggct      1440
     ccatga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page