(data stored in ACNUC7421 zone)

EMBL: CP001349.PE488

CP001349.PE488       Location/Qualifiers
FT   CDS_pept        565252..565395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55540"
FT                   /db_xref="GOA:B8ICF2"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF2"
FT                   /inference="similar to AA sequence:KEGG:M446_1680"
FT                   /protein_id="ACL55540.1"
FT                   /translation="MTPIARESPLPGAANAPALWESVPLDCLASALFVILAGALSLAGF
FT                   MP"
     atgaccccga tcgcccgcga gtctcccctg ccgggcgccg cgaacgcgcc tgccctctgg        60
     gagagcgttc cgctcgactg cctggcctcg gccctgttcg tgatcctggc gggcgccctg       120
     tcgcttgccg gattcatgcc ctga                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page