(data stored in ACNUC7421 zone)

EMBL: CP001349.PE489

CP001349.PE489       Location/Qualifiers
FT   CDS_pept        565506..565664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55541"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF3"
FT                   /inference="similar to AA sequence:KEGG:M446_1679"
FT                   /protein_id="ACL55541.1"
FT                   /translation="MVQEDDAMLMALLGRLAEAWHTVLASVTDPYRPELHYMRGPGPRW
FT                   RERHRKD"
     atggtgcagg aggacgacgc gatgctgatg gcccttctcg gccgcctcgc cgaggcgtgg        60
     cacaccgttc ttgcctcggt gaccgacccg taccggcccg agctccacta tatgcggggt       120
     cccggcccgc gctggcgcga gcgacaccga aaggactga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page