(data stored in ACNUC7421 zone)

EMBL: CP001349.PE49

CP001349.PE49        Location/Qualifiers
FT   CDS_pept        complement(56404..57411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0050"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   KEGG: mpo:Mpop_2099 2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55101"
FT                   /db_xref="GOA:B8IU56"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU56"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACL55101.1"
FT                   /translation="MSIAIVGAGAIGGYLGVRLAAAGESVTFIARGANLEAIRRTGMRL
FT                   IEEDGREVHVRDLRATASMQEAGPHDVVLLTLKAHQVGPIAQDLKHLIGPRTVVVTMQN
FT                   GIPWWYFHKHGGEYAGTQLETADPGGLIAAAIDPEQVIGSVVYPAAILTEPGVVKVVEG
FT                   SRFGLGELSGEMSERVQALAQLLIKAGFKAPVTNDIRAEIWLKLWGNLSFNPISALTHA
FT                   TLVDICQFPETRALASEMMREAETIANTLGITFRLGIERRIAGAEKVGAHKTSMLQDVE
FT                   AGRPIELEALVGSVIELGRLTKTPTPHIDAVYACMRLLARTLEQQKGRLQVQPV"
     atgagcatcg cgatcgtggg ggcgggcgcc atcggcggct atctgggcgt tcggctcgcc        60
     gcggcgggcg agtcggtgac cttcatcgcg cgcggcgcga acctggaggc catccggcgc       120
     accggcatgc gcctcatcga ggaggacggc cgcgaggtgc atgtgcgcga cctcagggcg       180
     acggcctcga tgcaggaggc cggcccgcac gacgtggtgc tgctcaccct caaggcgcat       240
     caggtcggcc cgatcgccca ggacctcaaa cacctcatcg gcccccggac ggtggtcgtg       300
     acgatgcaga acggcatccc gtggtggtac ttccacaagc acgggggcga gtatgcgggc       360
     acgcagctcg agaccgccga tccgggcggc ctgatcgccg cagcgatcga ccccgagcag       420
     gtcatcggca gcgtggtcta cccggccgcg atcctcaccg agccgggcgt ggtgaaggtg       480
     gtggaaggct cgcgcttcgg cctcggtgag ctctcgggcg agatgtcgga gcgcgtccag       540
     gccctggcgc agctgctgat caaggccggg ttcaaggcgc cggtgacgaa cgacatccgg       600
     gccgagatct ggctgaagct gtgggggaac ctgagcttca acccgatcag cgcgcttacc       660
     cacgcgacgc tcgtcgacat ctgccagttc cccgagaccc gggcgctcgc ctccgagatg       720
     atgcgcgagg cggagaccat cgccaacacg ctcggcatca ccttccggct cggcatcgag       780
     cggcgcatcg cgggcgccga gaaggtcggc gcgcacaaga cctcgatgct gcaggacgtc       840
     gaggccggcc ggccgatcga gctcgaggcg ctggtcggct cggtgatcga gctcgggcgc       900
     ctgacgaaga cgccgacgcc gcatatcgat gcggtctatg cctgcatgcg gctgctcgcc       960
     cgcacgctgg agcagcagaa gggccggctc caggtccagc cggtctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page