(data stored in ACNUC7421 zone)

EMBL: CP001349.PE490

CP001349.PE490       Location/Qualifiers
FT   CDS_pept        complement(565785..566216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55542"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF4"
FT                   /inference="similar to AA sequence:KEGG:M446_1940"
FT                   /protein_id="ACL55542.1"
FT                   /translation="MMRWLGLVSAVLAAGGPEPVRLRPGAYEVEVRLDLPHLDEAGARK
FT                   IVRLCLAGLPAQGFPVLSDNTPFAHCPATGLRQEGEAVHFAIQCEGRNAGQGSAIYRLA
FT                   PEGFEGRIALRLGGKNMTLTELQTGRWRGECAPGDRPLP"
     atgatgcgat ggctgggatt ggtgagcgcg gtgctcgcgg ccggcgggcc ggagccggtg        60
     cgcctgcgcc cgggcgccta cgaggtggag gtccgcctcg acctgccgca tctcgacgag       120
     gccggagccc gcaagatcgt gcgcctgtgc ctcgcgggcc tgccggcgca aggctttccg       180
     gtattgagcg acaacacgcc gttcgcccac tgccccgcga ccggcctgcg ccaggagggc       240
     gaggccgttc actttgcgat ccagtgcgag ggacgcaatg cggggcaggg ctcggcgatc       300
     taccggctcg cgccggaggg gttcgagggg cgcatcgctc tgcggctcgg cggcaagaac       360
     atgaccctga ccgagctgca gaccggccgc tggcgcggcg agtgcgctcc cggcgaccgt       420
     ccgctgcctt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page