(data stored in ACNUC7421 zone)

EMBL: CP001349.PE491

CP001349.PE491       Location/Qualifiers
FT   CDS_pept        566399..567523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0501"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; Ada metal-binding domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: met:M446_1042 AraC
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55543"
FT                   /db_xref="GOA:B8ICF5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF5"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACL55543.1"
FT                   /translation="MKLPDPDPPVMRPDEAACRAALARRDPAADGTFVYAVRTTGVYCR
FT                   PSCPARTARPENVSFYATCAEAEAAGFRPCRRCRPNEPGLAARQAEAVARACRLIEEAE
FT                   TPPSLDALSRTEGLSPYHFHRIFKRITGVTPKAYAAARRAARLESGLLRDAGTVTEAIF
FT                   EAGYGTSSRFYAAAAARLGMTPTAYRRGGAGTAIRFAVAACSLGAVLVAATQKGVCAIM
FT                   LGDDPEALVRDLQDRFPRAELTGGDAEFETVVAQVVGLVEAPGTARFDLPLDINGTAFQ
FT                   QRVWQALRAIPPGRTATYTQIAQAIGEPKAVRAVAQACGANPLAVAIPCHRVVRHDGAL
FT                   SGYRWGVARKRDLLARESTTTRDEAQGDLALDGK"
     atgaagcttc ccgaccccga tcccccggtg atgcgccccg acgaggccgc ctgccgggcc        60
     gcgctcgccc gacgcgatcc ggccgccgac ggcaccttcg tctacgcggt gcggacgacc       120
     ggcgtgtatt gccgcccgag ctgcccggcc cgcacggcgc gccccgagaa cgtgtccttc       180
     tacgcgacct gcgcggaggc ggaggcggcg ggcttccgtc cctgccgccg ctgccgcccc       240
     aacgagccgg ggctcgccgc gcggcaggcc gaggcggtgg cccgcgcctg ccggctgatc       300
     gaggaggcgg agacgccgcc ctccctcgat gcgctctccc gcacggaggg cctgagcccc       360
     tatcacttcc accgcatctt caagaggatc accggcgtga ctcccaaagc ctatgcggcc       420
     gcgcggcgcg cggcgcggct cgaatccggc ctgctgcgcg acgccggcac cgtgacggag       480
     gcgatcttcg aggccggcta cggcacgtcg agccgcttct acgccgcggc ggcggcgcgc       540
     ctcggcatga ccccgaccgc ctatcgccgg ggcggcgccg gcacggcgat ccgctttgcc       600
     gtggccgcct gctccctcgg ggccgtcctg gtcgcggcga cccagaaggg cgtctgcgcg       660
     atcatgctcg gcgacgaccc ggaggcgctg gtgcgcgatc ttcaggaccg ctttccccgg       720
     gccgagctga ccgggggcga cgcggaattc gagaccgtcg tcgcgcaggt ggtgggcctc       780
     gtcgaggcgc cggggacggc ccgtttcgac ctcccgctcg acatcaacgg caccgccttc       840
     cagcagcggg tctggcaggc gctgcgggcg atcccgccgg gccggaccgc cacctacacg       900
     cagatcgcgc aggccatcgg cgagccgaag gccgtgcggg cggtggccca ggcctgcggc       960
     gccaacccgc tcgccgtcgc gatcccctgc caccgggtgg tgcgccacga cggggcgctc      1020
     tccggctatc gctggggcgt ggcccgcaag cgggatcttc tggcccgcga gagcacgact      1080
     acgcgcgacg aggcccaggg cgacctcgcc ctggacggca agtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page