(data stored in ACNUC7421 zone)

EMBL: CP001349.PE492

CP001349.PE492       Location/Qualifiers
FT   CDS_pept        complement(568306..568767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55544"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF6"
FT                   /inference="similar to AA sequence:KEGG:M446_1044"
FT                   /protein_id="ACL55544.1"
FT                   /translation="MMLRPTLAVTILVALAAPAAAQPRPKAPPPPPKEAAPPPDAAAGL
FT                   LFPCRSETEICYIGVAKDGKLTVLFTNDPKGETISGKPLAVAGEGPNAPDLAKNDGKVV
FT                   MLVGTYDPKAGLTKAELVDVAGPLLAFAIKGSLGGGGEERAPPPAPKRR"
     gtgatgctgc gcccaacgct cgccgtgacc atcctcgtcg cccttgccgc cccggcggcg        60
     gcccagccgc ggccgaaggc accgcccccg cccccgaagg aggctgcccc gccgccggac       120
     gccgccgcgg gcctgctctt cccctgccgg agcgagacgg agatctgcta catcggcgtc       180
     gccaaggacg gcaagctgac cgtgctcttc accaacgacc cgaagggcga gacgatctcc       240
     ggcaagccgc tcgccgtggc gggggagggg cccaacgctc ccgacctcgc caagaacgac       300
     ggcaaggtgg tgatgctcgt cggcacctac gacccgaagg ccggcctcac caaggccgag       360
     ctcgtggatg tggcgggccc gctcctcgcc ttcgccatca aggggtccct cggcggcggg       420
     ggtgaggagc gggccccgcc gccggcgccc aagcggaggt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page