(data stored in ACNUC7421 zone)

EMBL: CP001349.PE493

CP001349.PE493       Location/Qualifiers
FT   CDS_pept        complement(568944..569966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_1710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55545"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF7"
FT                   /inference="similar to AA sequence:KEGG:RPD_1710"
FT                   /protein_id="ACL55545.1"
FT                   /translation="MQRHGLPALMLFCALTAVTGVAGAKDAETWRVEGKLVGKDKKSKD
FT                   VSGIACAPANGGQARKCLVIDDNLQAAQIVELHADHLKTDKDQKVPLIRNEFGGEALEL
FT                   DGEGVAYADGLFYVIGSHGHPRDKKGKLKSAEHADMVAARIAAASQIVRVRLSPEGKGS
FT                   VVPPVASLTRAIEAEPALAPFAGRRLENDGVTIEGIAVRGDRLYAGFRGPPLDNGRAAV
FT                   LAVDLGSAFGEAPAKPSRLFRLPVGERRGVRDLAVHGTKILVLVGPVGDEPGPSSIYEW
FT                   DGESDEAIRSLGDLGALAGVSPKQKPEAILPLDTTPSGLRVLVMFDGEEEGAPIVVTLP
FT                   "
     atgcagaggc acggtctgcc ggcgctgatg ctgttttgcg ctctgacggc cgtcacgggg        60
     gtggccggcg ccaaggacgc cgaaacctgg cgcgtcgagg gcaagctggt cggcaaggac       120
     aagaagtcca aggacgtcag cggcatcgcc tgcgctccgg cgaacggcgg tcaggctcgc       180
     aagtgcctcg tcatcgacga caatctgcag gccgcccaga tcgtcgagct gcatgccgat       240
     catctcaaga ctgacaagga tcagaaggtc ccgctgatca ggaacgagtt cggcggtgaa       300
     gcgctcgagc tcgacggcga gggcgtcgcc tacgcggacg gccttttcta cgtcatcgga       360
     tcgcacgggc atccgcggga caagaagggc aagctcaagt cggcggagca tgccgacatg       420
     gtcgcggcgc ggatcgccgc ggccagccag atcgtgcgcg tcaggctgtc cccggagggc       480
     aaggggtcgg tcgtgccccc ggtggcttcg ctcaccaggg ccatcgaggc cgagccggcc       540
     ctcgcgccct tcgccggacg gcggctggag aacgacggcg tgaccatcga ggggatcgcc       600
     gtgaggggag accggctcta cgcggggttc cgcggcccgc cgctcgacaa cgggcgcgcc       660
     gcggtcctgg cggtggacct cggcagtgcc ttcggagagg cgccggcgaa gccctcccgg       720
     ctgttccggc tgccggtcgg cgaacgccgg ggcgtccgcg acctcgcggt gcacgggacg       780
     aagatcctgg tcctggtcgg ccccgtcggc gacgagccgg ggccgtcctc catctacgaa       840
     tgggacggtg agagcgacga ggccatccgc agcctgggcg atctcggagc ccttgcgggt       900
     gtctccccca agcaaaagcc ggaggcgatc ctcccgctgg atacgacgcc gtcgggcctg       960
     cgcgtcctcg tcatgttcga cggcgaggag gagggcgcac cgatcgtcgt gacgctgccc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page